Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_027720856.1 H589_RS0104095 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000425265.1:WP_027720856.1 Length = 358 Score = 199 bits (506), Expect = 9e-56 Identities = 128/353 (36%), Positives = 200/353 (56%), Gaps = 23/353 (6%) Query: 6 VKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD 65 VKN+ K + + A+ NV ++E GE +LGPSG GKTT +R IAG + + G + Sbjct: 7 VKNIDKFYDQFH--AVKNVTFSLEEGEIGCLLGPSGCGKTTLLRTIAGFEDIAAGSIIIA 64 Query: 66 DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVA 125 D+LVA G+ VPPE R IGMVFQ +AL+P+L ENIAF + + ++ KR++++ Sbjct: 65 DKLVA--GQRTVPPEKRNIGMVFQDYALFPHLKVGENIAFGIEELPPAERS--KRIDDLL 120 Query: 126 KILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKE 185 + +++ + +P ELSGGQQQRVALARAL +P LLL+DEPFSNLD +R++ ++E Sbjct: 121 RTVELDGSGDKYPHELSGGQQQRVALARALAPEPKLLLMDEPFSNLDVALRETLSTEIRE 180 Query: 186 VQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEIN 245 + +T L+V+H+ + FA+AD+VGVL G + Q P +Y +P + VA +GE Sbjct: 181 ILKDRSITALMVTHNQNEAFAMADKVGVLSCGSMQQWDTPHSIYHHPSNPVVAGFVGEGV 240 Query: 246 ELEGKVTNEGVV---IGSLRFPVSV---SSDRAIIGIRPEDVKLSKDVIKDDSWILVGKG 299 ++ ++ + +G L+ + S +A + IRPE DVI DD + Sbjct: 241 FIDAEIVEGNTIKCALGELQSDFKLNLESGTQAKLLIRPE------DVIHDDDSPYGAEI 294 Query: 300 KVKVIGYQGGLFRITITPLDSEEEIFTY--SDHPIHSGEEVLVYVRKDKIKVF 350 K L+++ LD+ EEI + S H G+ + +Y + + +F Sbjct: 295 IAKTFRGPNILYKL---KLDNGEEILSLVPSHHQHAVGQRIGIYQEVEDLVLF 344 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 358 Length adjustment: 29 Effective length of query: 324 Effective length of database: 329 Effective search space: 106596 Effective search space used: 106596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory