Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_027723182.1 H589_RS0117235 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_000425265.1:WP_027723182.1 Length = 396 Score = 149 bits (376), Expect = 1e-40 Identities = 77/222 (34%), Positives = 128/222 (57%), Gaps = 6/222 (2%) Query: 21 VKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEGNLYIGDRRVNDVPPKD---- 76 V + + + + E V +G SG GK+T +R I L + T G ++I + + + Sbjct: 43 VNNASFSVDEGEIVVVMGLSGSGKSTLVRCINRLIEPTGGKIFIDGTDITKLSQNELRKV 102 Query: 77 --RDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAAKILDIAHLLDRKPK 134 + MVFQN+AL+PH TV +N +GL++ V ++ EA +++ +A + P Sbjct: 103 RLEKLGMVFQNFALFPHRTVLKNAEYGLEINGVDPETRKQKATEALELVGLAGWENSYPP 162 Query: 135 ALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLHQRLQTTVIYVTH 194 LSGG +QRV L RA+ +P + LMDE S LD +R M+ E+ L +R+ T+++++H Sbjct: 163 QLSGGMQQRVGLARALALDPDILLMDEAFSALDPLIRRDMQDELINLQERMHKTIVFISH 222 Query: 195 DQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFI 236 D EA+ +GD+IV+M+DG I Q TP+ + + P N +V F+ Sbjct: 223 DLDEALKIGDKIVLMKDGEIVQTGTPEEILTSPANDYVRRFV 264 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 396 Length adjustment: 31 Effective length of query: 353 Effective length of database: 365 Effective search space: 128845 Effective search space used: 128845 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory