Align Benzoyl-CoA reductase electron transfer protein, selenocysteine-containing, putative (characterized, see rationale)
to candidate WP_027720840.1 H589_RS0104000 hydrogenase iron-sulfur subunit
Query= uniprot:Q39TW2 (255 letters) >NCBI__GCF_000425265.1:WP_027720840.1 Length = 141 Score = 130 bits (327), Expect = 1e-35 Identities = 55/131 (41%), Positives = 87/131 (66%), Gaps = 1/131 (0%) Query: 6 DHKPSVVGFLCTWUAYGAADLAGVSRLQYTTETKIIRVMCTGRVDLAFVLRAFSKGADGV 65 + +P+++ F+C W Y AADLAG SR+ +++R+MCTG VD +V++A GADGV Sbjct: 4 EFEPTLLAFVCNWCTYTAADLAGTSRMVQQPNLRLVRMMCTGMVDPKYVIKALLSGADGV 63 Query: 66 FIGGCWPGECHYVTEGNYDVLKNVHIAKKILERIGINPDRLRLEWIAASEGMRYAEVMND 125 + GC PG+CHY+ GN+ + + + +IL + GI +R++L WI ASEG +A +N+ Sbjct: 64 LVSGCHPGDCHYI-NGNFKARRRIKLLNEILPQFGIERERVKLTWIGASEGNEFAATVNN 122 Query: 126 FGKRLKELGPL 136 F ++ELGP+ Sbjct: 123 FINEIRELGPM 133 Lambda K H 0.321 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 87 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 141 Length adjustment: 20 Effective length of query: 235 Effective length of database: 121 Effective search space: 28435 Effective search space used: 28435 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory