Align Benzoyl-CoA reductase electron transfer protein, selenocysteine-containing, putative (characterized, see rationale)
to candidate WP_027723114.1 H589_RS0116885 hydrogenase iron-sulfur subunit
Query= uniprot:Q39TW2 (255 letters) >NCBI__GCF_000425265.1:WP_027723114.1 Length = 154 Score = 133 bits (334), Expect = 2e-36 Identities = 59/144 (40%), Positives = 91/144 (63%), Gaps = 1/144 (0%) Query: 11 VVGFLCTWUAYGAADLAGVSRLQYTTETKIIRVMCTGRVDLAFVLRAFSKGADGVFIGGC 70 +VGFLC W +YG AD AGV R T+ +II+V C+GR+D F+++ GADGV + GC Sbjct: 11 IVGFLCNWCSYGGADTAGVGRFDQPTDLRIIKVPCSGRIDPLFIVKTLMSGADGVLVSGC 70 Query: 71 WPGECHYVTEGNYDVLKNVHIAKKILERIGINPDRLRLEWIAASEGMRYAEVMNDFGKRL 130 P +CHY EGN+ + + + K+ + +GI+P+R W++ASEG R+ EV+ F +++ Sbjct: 71 HPNDCHY-AEGNFYARRRLEMLKRFIPMLGIDPNRFDYTWVSASEGQRWQEVVTKFTEQI 129 Query: 131 KELGPLGKGEGIEPGALKLRLEAA 154 +LGP K EG + +EA+ Sbjct: 130 HKLGPAQKIEGADAEETLKLMEAS 153 Lambda K H 0.321 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 109 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 154 Length adjustment: 20 Effective length of query: 235 Effective length of database: 134 Effective search space: 31490 Effective search space used: 31490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory