Align Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale)
to candidate WP_027722302.1 H589_RS0112340 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:G8ALJ3 (366 letters) >NCBI__GCF_000425265.1:WP_027722302.1 Length = 391 Score = 209 bits (532), Expect = 1e-58 Identities = 121/353 (34%), Positives = 184/353 (52%), Gaps = 5/353 (1%) Query: 18 ASVAKADIAVATAGPITGQYATFGEQMKKGIEQAVADINAAGGVLGQKLKLEVGDDACDP 77 A V+ I + G +G A++G + + V +N AGG+ G ++ L + DD C P Sbjct: 40 APVSAKTILLGVPGAHSGDLASYGLPTVEAAKLVVKAVNDAGGINGAQVVLSMQDDQCKP 99 Query: 78 KQAVAVANQLAKAGVKFVAGHFCSGSSIPASQVYAEEGVLQISPASTNPKLTEQ-NLKNV 136 + A A +L V GH CSG++ A +Y E ++ +SP++TNP LT+ + N Sbjct: 100 EFATNAAFKLVSDKATVVLGHICSGATKAALPIYKESNLVCMSPSATNPALTQSGDYPNF 159 Query: 137 FRVCGRDDQQGQIAGKYLLENYKGKNVAILHDKSAYGKGLADETQKAL-NAGGQKEKIYE 195 FR DD Q +A K+ +EN KN+AI+HDK YGKG A+ +K + +G K ++E Sbjct: 160 FRTIASDDAQAALASKFAMENLGLKNIAIIHDKGDYGKGFAEFAKKYVEESGSAKVALFE 219 Query: 196 AYTAGEKDYSALVSKLKQEAVDVVYVGGYHTEAGLLARQMKDQGLNAPIVSGDALVTNEY 255 T G DYSA+V K++ D V GGYH EA + QM+ + + P +S D + + Sbjct: 220 GVTPGAVDYSAVVQKIRASGADGVIFGGYHPEASKIVSQMRKKKMTVPFISDDGVKAKTF 279 Query: 256 WAITGPAGENTMMTFGPDPREMPEAKEAVEKFRKAGY--EPEGYTLYTYAALQIWAEAAK 313 + A E T D P K A+E++ KA + EP + Y+A +A + Sbjct: 280 IDVAAAAAEGVYATGPRDITANPMYKVALEQY-KASHEGEPGAFFFEAYSAAIALLKAIE 338 Query: 314 QANSTDSAKIADVLRKNSYNTVIGKIGFDAKGDVTSPAYVWYRWNNGQYAQVK 366 + STD KI + LR + T +GKI FD+KGD + Y+ NG+Y +VK Sbjct: 339 NSGSTDYDKIVEALRTHEVETPVGKIKFDSKGDAIGVGFSVYQVRNGEYVEVK 391 Lambda K H 0.312 0.129 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 391 Length adjustment: 30 Effective length of query: 336 Effective length of database: 361 Effective search space: 121296 Effective search space used: 121296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory