Align AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_027721172.1 H589_RS0105870 amino acid ABC transporter permease
Query= TCDB::Q52814 (384 letters) >NCBI__GCF_000425265.1:WP_027721172.1 Length = 477 Score = 263 bits (671), Expect = 1e-74 Identities = 148/346 (42%), Positives = 213/346 (61%), Gaps = 10/346 (2%) Query: 42 ILTILALALIAWAVPHLVNWLF-IQAVWSGPDRTFCATTLQGGIQPDGWSGACWAFISAK 100 I+ ++A L+ VP ++ +LF + ++ G T + L I G++G + ++ Sbjct: 136 IMALVAALLLFGPVPMIIVFLFAVLPMFFGRLSTNGSVPL---ITLQGFAGVAFRLLAGI 192 Query: 101 YDQFIFGRYP--LGERWRPAIVGILF-ILLLVPMLIPSAPRKGLNAILLFAVLPVIAFWL 157 I G LG +G++ +L+ V + + + ++LF P++AF L Sbjct: 193 VIGCIAGSISKELGAAETATYIGLVSGVLIWVLLQVRNLGAGAWQWVMLFTCFPLLAFIL 252 Query: 158 LHGG-FGLEVVETPLWGGLMVTLVLSFVGIAVSLPVGILLALGRRSRMPVIRMLCVTFIE 216 L G FGL VET WGGL +TLV++ G+ +LP+GILLALGRRS +PVIR +C+ FIE Sbjct: 253 LSGNAFGLAHVETHYWGGLFLTLVVAVTGMGTALPIGILLALGRRSTLPVIRTVCICFIE 312 Query: 217 VIRGVPLITVLFMASVMLPLFLPTGWNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKG 276 RG+PL++VLFM SVMLPL LP N DKLLRALIG++ F +AYMAEV+RGGLQAIP Sbjct: 313 FARGIPLVSVLFMVSVMLPLMLPHDVNFDKLLRALIGIAFFYAAYMAEVVRGGLQAIPSQ 372 Query: 277 QFEGADSLGLGYWQKTRLIIMPQAIKLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKL 336 Q+E A +LG YW+ II+PQ ++L+IP + N F+ KDT+LV +IG+FDLLGI K Sbjct: 373 QYEAAQALGWTYWRMMFKIILPQTLRLIIPGLANNFLSLLKDTTLVAVIGLFDLLGISKA 432 Query: 337 NFSDANWASAVTPITGLIFAGFIFWLFCFGMSRYSGFMERHLDTGH 382 +DA+W +F+ +FW+ CF MSRY ++ER T + Sbjct: 433 AMADADWLGFTK--ESYLFSAMVFWILCFCMSRYFLYLERKYHTSY 476 Score = 89.0 bits (219), Expect = 3e-22 Identities = 52/192 (27%), Positives = 94/192 (48%), Gaps = 22/192 (11%) Query: 18 PPPPGERGAVAWIRRNLLATPKDVILTILALALIAWAVPHLVNWLFIQAVWSGPDRTFC- 76 P P G + W+R+NL ++P + ILT+ ++ L+ + L+ W + A W G R C Sbjct: 12 PSPIQSTGPIGWMRKNLFSSPANSILTLFSVYLLYILITPLIQWAVVDATWLGNSRACCD 71 Query: 77 -ATTLQGGIQPDGWSGACWAFISAKYDQFIFGRYPLGERWRPAIVGILFILLLVPMLIPS 135 A L G +GACW F+ + + F++G YP E+WR + ++ + +P+L+P Sbjct: 72 EAAAL-------GKNGACWTFVKVRLNMFLYGFYPKAEQWRINFIMLILLFHALPILLPD 124 Query: 136 APRKGLNAILLFAVLPVIAFWLLHGGFGLEVV----ETPLWGGLMVT-------LVLSFV 184 + + F ++ ++A LL G + +V P++ G + T + F Sbjct: 125 IINR--KKRIGFTIMALVAALLLFGPVPMIIVFLFAVLPMFFGRLSTNGSVPLITLQGFA 182 Query: 185 GIAVSLPVGILL 196 G+A L GI++ Sbjct: 183 GVAFRLLAGIVI 194 Lambda K H 0.330 0.145 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 679 Number of extensions: 43 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 384 Length of database: 477 Length adjustment: 32 Effective length of query: 352 Effective length of database: 445 Effective search space: 156640 Effective search space used: 156640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory