Align Ribokinase; RK; EC 2.7.1.15 (uncharacterized)
to candidate WP_027722988.1 H589_RS0116170 PfkB family carbohydrate kinase
Query= curated2:P36945 (293 letters) >NCBI__GCF_000425265.1:WP_027722988.1 Length = 294 Score = 55.5 bits (132), Expect = 1e-12 Identities = 73/274 (26%), Positives = 107/274 (39%), Gaps = 41/274 (14%) Query: 38 GGKGANQAVAAARLGAQVFMVGKVGDDHYGTAILNNLKANGVRTDYMEPVTHTESGTAHI 97 GG N A A LGA+ F + +GDD G + L G+ +E V+ + Sbjct: 24 GGAPVNFAYHAGALGAEAFAISTIGDDERGRRAIAELLTRGLN---LESVSVDKDHATGF 80 Query: 98 VLAEGDNSIVVVKGANDDITPAY-ALN--ALEQIEKVDMVLIQQEIPEETVDEVCKYCHS 154 V A+ D+ V DDI + LN ALE KVD V Sbjct: 81 VEAKVDSQGVAHYIFPDDIAWDHLTLNERALELAPKVDAVCFGTLAQRSEKSRAA----- 135 Query: 155 HDIPIILNPAPA---------------RPLKQETIDHATYLTPNEHEASILFPELTIS-- 197 I I L+ AP + ++ A L N+ E S++ ++ Sbjct: 136 --ISIFLDNAPQAMKIYDMNLRQNFYNEEIINRSLQKADVLKLNDDEISVVASMFGLNGD 193 Query: 198 --EALALYPAKL-----FITEGKQGVRYSAGSKEVLIPSFPVEPV-DTTGAGDTFNAAFA 249 L + K +T G G +KE+ V+ + DT GAGD+F AA A Sbjct: 194 EKSILKVLHEKFTLKCSVLTRGGSGSLMLGQNKEIENSGIYVDKITDTIGAGDSFTAAVA 253 Query: 250 VALAEGKDIEAALRFANRAASLSVCSFGAQGGMP 283 + L +G +E+ + AN A+ VCS +G MP Sbjct: 254 IGLLQGCTLESISKHANELAAY-VCS--CKGAMP 284 Lambda K H 0.315 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 293 Length of database: 294 Length adjustment: 26 Effective length of query: 267 Effective length of database: 268 Effective search space: 71556 Effective search space used: 71556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory