Align MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_027723039.1 H589_RS0116465 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::O30494 (367 letters) >NCBI__GCF_000425265.1:WP_027723039.1 Length = 365 Score = 325 bits (833), Expect = 1e-93 Identities = 175/363 (48%), Positives = 239/363 (65%), Gaps = 16/363 (4%) Query: 1 MANLKIKNLQKGFEGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGTI 60 MAN+++KN+ K + +I G+DL VN+ EF+V VGPSGCGKSTLLR++AGLE +S G I Sbjct: 1 MANVELKNVIKRYGSVEVIHGVDLSVNENEFIVLVGPSGCGKSTLLRMVAGLENLSGGEI 60 Query: 61 ELDGRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKQLVESKVNEAARI 120 + R + V+P R++AMVFQ YALYPHM+V +NM F+L + K+ +ES+VNEAARI Sbjct: 61 HIGDRVVNNVSPKDRNVAMVFQNYALYPHMTVGENMGFSLKMHKRSKEEIESRVNEAARI 120 Query: 121 LELGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLH 180 LEL P L RKP +LSGGQRQRVA+GRA+VRNP +FLFDEPLSNLDA LR QMR+EL ++H Sbjct: 121 LELEPYLHRKPAELSGGQRQRVAMGRAMVRNPDVFLFDEPLSNLDAQLRTQMRMELRKMH 180 Query: 181 KELQATMIYVTHDQVEAMTLADKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLGTPKMG 240 L+ T IYVTHDQ+EAMTLAD++V+L G I+QVGSP+E++ +P N+FVA F+G P M Sbjct: 181 LRLRTTTIYVTHDQIEAMTLADRIVILKDGYIQQVGSPVEVFEKPNNVFVAKFIGNPPMN 240 Query: 241 FLKGKVTRVDGQGCEVQLDAGTLISLPLSGASLSV--GSAVTLGIRPEHLEIASPGQTTL 298 L+G +DG+ V G G + S+ GS V G+RP+ +++ GQ Sbjct: 241 ILEGVCKVIDGKRYVV---IGKTRFPIQDGVAKSIVDGSPVLAGLRPDSIKM---GQNIE 294 Query: 299 TVTAD--------VGERLGSDTFCHVITSNGEPLTMRIRGDMASQYGETLHLHLDPAHCH 350 + D V E LG+ + ++ L + G + + GET+ + + Sbjct: 295 RLPKDWWCHGEVVVSEILGAHSLLEIVIDGENELIAEVEGRIIAHPGETVPIGFEFDRMV 354 Query: 351 LFD 353 LFD Sbjct: 355 LFD 357 Lambda K H 0.319 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 365 Length adjustment: 30 Effective length of query: 337 Effective length of database: 335 Effective search space: 112895 Effective search space used: 112895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory