Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_027723168.1 H589_RS0117160 3-oxoacyl-[acyl-carrier-protein] reductase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_000425265.1:WP_027723168.1 Length = 247 Score = 127 bits (320), Expect = 2e-34 Identities = 90/242 (37%), Positives = 130/242 (53%), Gaps = 16/242 (6%) Query: 21 ALVTGGAQGIGFEIARGLAQAGARVTIADLN-PDVGEGAARELDGTFER-----LNVTDA 74 ALVTGG++GIG A+ LA G V I ++ PD E +++ + L+ +D Sbjct: 8 ALVTGGSRGIGEACAKKLASDGFEVFITYVSRPDGAEKVCADIEAAGGKAKAFKLDSSDR 67 Query: 75 DAVADLARR----LPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWCCREFGR 130 +AV + +DVLVNN GI R+ D DW V+ VNL G F C RE + Sbjct: 68 EAVTAFFKEEIKGKVKLDVLVNNGGITRDGLLVRMKDADWDRVMDVNLTGAFTCLRESAK 127 Query: 131 TMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRVNAVAP 190 M+ + G +++ +S+ G N QA Y ++KA +I LT++ A E A RGV VNAVAP Sbjct: 128 IMMKQRYGRVINISSIVGQSGN--AGQANYVSAKAGLIGLTKASAIELAPRGVTVNAVAP 185 Query: 191 GYTATPLTRRGLETPE-WRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHTLVVD 249 G+ T +T E PE + PL +L +IA AV +LA + + ++TG TL V+ Sbjct: 186 GFIQTDMT---AELPENVMAHMMDNIPLKKLGTSDDIANAVSFLAKEESGYITGQTLAVN 242 Query: 250 GG 251 GG Sbjct: 243 GG 244 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 247 Length adjustment: 24 Effective length of query: 231 Effective length of database: 223 Effective search space: 51513 Effective search space used: 51513 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory