Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_027723039.1 H589_RS0116465 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000425265.1:WP_027723039.1 Length = 365 Score = 326 bits (836), Expect = 5e-94 Identities = 177/363 (48%), Positives = 242/363 (66%), Gaps = 7/363 (1%) Query: 1 MTGLLLKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDM 60 M + LK++ K YG+V+VIHG+DL + E EF+V VGPSGCGKSTLLRM+AGLE ++GG++ Sbjct: 1 MANVELKNVIKRYGSVEVIHGVDLSVNENEFIVLVGPSGCGKSTLLRMVAGLENLSGGEI 60 Query: 61 FIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADM 120 I VN+V P R +AMVFQ+YALYPHMTV +NM F +++ + SKEEI+ RV AA + Sbjct: 61 HIGDRVVNNVSPKDRNVAMVFQNYALYPHMTVGENMGFSLKMHKRSKEEIESRVNEAARI 120 Query: 121 LQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLS 180 L+L PYL R P LSGGQRQRVA+GRA+ RNP VFLFDEPLSNLDA LR R+E+ K+ Sbjct: 121 LELEPYLHRKPAELSGGQRQRVAMGRAMVRNPDVFLFDEPLSNLDAQLRTQMRMELRKMH 180 Query: 181 ERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAM 240 R+ TT IYVTHDQ+EAMTLADRIV+L G+I+QVG+P+E++E+P N+FVA+FIG+P M Sbjct: 181 LRLR-TTTIYVTHDQIEAMTLADRIVILKDGYIQQVGSPVEVFEKPNNVFVAKFIGNPPM 239 Query: 241 NVIPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTE-----ADD 295 N++ + V + + D + +G G+RP+ +++ + D Sbjct: 240 NILEGVCKVIDGKRYVVIGKTRFPIQDGVAKSIVDGSPVLAGLRPDSIKMGQNIERLPKD 299 Query: 296 FLFEGTVSIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFDT 355 + G V + E LG +LL I ENE +IA++ G G+ V + ++ LFD Sbjct: 300 WWCHGEVVVSEILGAHSLLEIVIDGENE-LIAEVEGRIIAHPGETVPIGFEFDRMVLFDP 358 Query: 356 NGQ 358 Q Sbjct: 359 QTQ 361 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 365 Length adjustment: 29 Effective length of query: 333 Effective length of database: 336 Effective search space: 111888 Effective search space used: 111888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory