Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_027723039.1 H589_RS0116465 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_000425265.1:WP_027723039.1 Length = 365 Score = 325 bits (833), Expect = 1e-93 Identities = 180/388 (46%), Positives = 245/388 (63%), Gaps = 36/388 (9%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M ++L N+ KRY + + + +L +++ EFIV VGPSGCGKST LRM+AGLE+++ G Sbjct: 1 MANVELKNVIKRYGSVE--VIHGVDLSVNENEFIVLVGPSGCGKSTLLRMVAGLENLSGG 58 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 ++I D+++N+ SPKDR++AMVFQNYALYPHM+V ENM F LK+ K K++I RV+EAA Sbjct: 59 EIHIGDRVVNNVSPKDRNVAMVFQNYALYPHMTVGENMGFSLKMHKRSKEEIESRVNEAA 118 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 IL L +L RKPA+LSGGQRQRVAMGRA+VR+ VFL DEPLSNLDA+LR MR E+ K Sbjct: 119 RILELEPYLHRKPAELSGGQRQRVAMGRAMVRNPDVFLFDEPLSNLDAQLRTQMRMELRK 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 +H R+ TTIYVTHDQ EAMTLADRIVI+ G I+Q+G+P E++ +P N Sbjct: 179 MHLRLRTTTIYVTHDQIEAMTLADRIVILKD----------GYIQQVGSPVEVFEKPNNV 228 Query: 241 FVAGFIGSPAMNFFE-----------VTVEKERLVNQDGLSLALPQGQEKILEEKGYLGK 289 FVA FIG+P MN E V + K R QDG++ ++ G Sbjct: 229 FVAKFIGNPPMNILEGVCKVIDGKRYVVIGKTRFPIQDGVAKSIVD------------GS 276 Query: 290 KVTLGIRPEDISSDQIVHETFPNASVTADILVSELLGSESMLYVKF-GSTEFTARVNARD 348 V G+RP+ I Q + + +++VSE+LG+ S+L + G E A V R Sbjct: 277 PVLAGLRPDSIKMGQNIERLPKDWWCHGEVVVSEILGAHSLLEIVIDGENELIAEVEGRI 336 Query: 349 SHSPGEKVQLTFNIAKGHFFDLETEKRI 376 PGE V + F + FD +T++ + Sbjct: 337 IAHPGETVPIGFEFDRMVLFDPQTQEAL 364 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 365 Length adjustment: 30 Effective length of query: 347 Effective length of database: 335 Effective search space: 116245 Effective search space used: 116245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory