Align 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase; 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; HHED aldolase; 4-hydroxy-2-ketoheptane-1,7-dioate aldolase; HKHD aldolase; EC 4.1.2.52 (characterized)
to candidate WP_035075834.1 H589_RS0110555 2-keto-3-deoxy-L-rhamnonate aldolase
Query= SwissProt::Q47098 (262 letters) >NCBI__GCF_000425265.1:WP_035075834.1 Length = 265 Score = 293 bits (749), Expect = 3e-84 Identities = 145/250 (58%), Positives = 183/250 (73%) Query: 1 MENSFKAALKAGRPQIGLWLGLSSSYSAELLAGAGFDWLLIDGEHAPNNVQTVLTQLQAI 60 ++N FK A+ G QIGLWL +SSY AE+ A + +DWLLIDGEHAPNNVQ++L QLQA+ Sbjct: 3 IKNKFKEAITKGEVQIGLWLSTASSYMAEMAATSDYDWLLIDGEHAPNNVQSLLGQLQAV 62 Query: 61 APYPSQPVVRPSWNDPVQIKQLLDVGTQTLLVPMVQNADEAREAVRATRYPPAGIRGVGS 120 APYP+ PVVRP D +KQ+LD+G QT+LVPMV A++AR V A RYPP G RGVG+ Sbjct: 63 APYPAHPVVRPLKGDTALLKQVLDIGAQTVLVPMVDTAEDARNMVAALRYPPKGKRGVGA 122 Query: 121 ALARASRWNRIPDYLQKANDQMCVLVQIETREAMKNLPQILDVEGVDGVFIGPADLSADM 180 ++ARASRW R+PDY+ A + +C+LVQ E+ EA++NL +ILDV+GVDGVFIGPADLSA M Sbjct: 123 SIARASRWMRVPDYMAHAEENLCLLVQAESCEALENLDEILDVDGVDGVFIGPADLSASM 182 Query: 181 GYAGNPQHPEVQAAIEQAIVQIRESGKAPGILIANEQLAKRYLELGALFVAVGVDTTLLA 240 G+ + HPEVQAAIE I +IRE GKA G L + +A + +E GA FVAV VDT Sbjct: 183 GHPDDAGHPEVQAAIEHCIRRIREKGKAAGTLAVDPDMAHKCIEWGATFVAVAVDTMAYI 242 Query: 241 RAAEALAARF 250 A +A F Sbjct: 243 DAIDAALVPF 252 Lambda K H 0.317 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 265 Length adjustment: 25 Effective length of query: 237 Effective length of database: 240 Effective search space: 56880 Effective search space used: 56880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory