Align AraU, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_027723036.1 H589_RS0116450 carbohydrate ABC transporter permease
Query= TCDB::Q97UF3 (295 letters) >NCBI__GCF_000425265.1:WP_027723036.1 Length = 281 Score = 135 bits (339), Expect = 1e-36 Identities = 89/286 (31%), Positives = 152/286 (53%), Gaps = 20/286 (6%) Query: 6 SKGSYIT--SSIKYALLEIIAAILVIMWLVPLYAMILGGLKSNLEAASTPILLPPSKPSL 63 +K IT S + Y LL ++A + +L+P Y I+ LK E + P+K Sbjct: 7 TKAGIITPRSVLLYGLLFLMA----LFFLMPAYMAIITALKPPAEINLSTAWELPAK--- 59 Query: 64 DAYAFAWFGYA-TIPGLEPTLLRYLLVAIPSVLLSVVIGTMTAYFFFVLSEKHGIISNGL 122 F W + + L+P ++ +++ + + +LS ++G++ Y F K S + Sbjct: 60 ----FHWSSFPEALRLLKPNIVSSVILTVCATVLSTILGSLNGYVFSKWKFKG---SELI 112 Query: 123 FSIMALATFLPIETVTFPLIELETSLNVYNTYIGLIFAMLIFYVPTSALLMSIFLPVVPK 182 F++ F+P + + PL + ++N+Y GLI A +++ +P ++L+ F +P Sbjct: 113 FTLFLFGMFIPYQVILIPLFQTLRAMNLYGGLPGLILAHVVYGLPITSLIFRNFYAQIPT 172 Query: 183 YLIESARMDGAGDWTILWRVVFPLIFPGFLSTLIFVFLQIWNEFFIPLILT-NTPNMLML 241 L+ESAR+DGAG ++I R+VFPL PGF+ T ++ QIWNEF + LT + N + + Sbjct: 173 ALVESARLDGAGFFSIYTRIVFPLSIPGFVVTSLWQVTQIWNEFLWGICLTRHADNPITV 232 Query: 242 PVAARFYTAAYALIYNRSFAAGVISSLIPLIIFIFLGRYFIRGLAA 287 +A A+ +N A ++++ L I+IFLGRYFIRGL A Sbjct: 233 GLAQ--LAGGQAVSWNLPMAGSIMAAAPVLAIYIFLGRYFIRGLLA 276 Lambda K H 0.330 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 281 Length adjustment: 26 Effective length of query: 269 Effective length of database: 255 Effective search space: 68595 Effective search space used: 68595 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory