Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_037375422.1 A3GO_RS0114000 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_000428045.1:WP_037375422.1 Length = 252 Score = 311 bits (797), Expect = 8e-90 Identities = 155/246 (63%), Positives = 191/246 (77%), Gaps = 1/246 (0%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 +L +KNV K FGGL AL D+NL + E HAIIGPNGAGKSTLLNC +G+LIPD+G+V F Sbjct: 4 VLSIKNVDKTFGGLHALGDINLDIEEGKTHAIIGPNGAGKSTLLNCCIGRLIPDSGTVEF 63 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQ 122 +GK+++G P+EIN G+ RVFQTPEIF DL+VL+N+MIP A+RDG F+ NA +++ + Sbjct: 64 EGKNMIGMQPHEINHAGMVRVFQTPEIFPDLTVLQNVMIPALARRDGTFKFNAFVSLASE 123 Query: 123 RDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARA 182 + I A H+LE+M + + H +A SMSRGDKRRLE+ M L Q PRLLLLDEPTAGMAR Sbjct: 124 KAIEADAVHILEDMGLGEHIHKHAGSMSRGDKRRLELAMGLVQHPRLLLLDEPTAGMARH 183 Query: 183 DTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPKV 242 DTN TIDLLK+IK ER +T IIEHDMHVVFSLAD I+VLAQG + P I+GNPKV Sbjct: 184 DTNRTIDLLKRIK-ERGMTKIIIEHDMHVVFSLADTISVLAQGRIIASGTPDEIRGNPKV 242 Query: 243 REAYLG 248 +EAYLG Sbjct: 243 QEAYLG 248 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 252 Length adjustment: 24 Effective length of query: 227 Effective length of database: 228 Effective search space: 51756 Effective search space used: 51756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory