Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_037374768.1 A3GO_RS22800 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000428045.1:WP_037374768.1 Length = 259 Score = 162 bits (409), Expect = 8e-45 Identities = 92/235 (39%), Positives = 130/235 (55%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 L LTVS G +LN V +L G++ LIGPNG GK+TLL + LL P+SGT+ Sbjct: 4 LHGTGLTVSLGGVTILNGVDFNLKAGEMLGLIGPNGAGKTTLLRVLAGLLKPRSGTLCWE 63 Query: 63 DNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVA 122 + LS ++ A+RLS L Q ++V+ LV+ GR P LS W R D A + Sbjct: 64 EADYLQLSPQERAKRLSYLAQSGTAHWPMSVERLVALGRLPHLSDWQRPGETDQALIAQV 123 Query: 123 MNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMG 182 M +T +N R+ LSGG+R R LA L V+L DEP LD+ HQ+++M L+ Sbjct: 124 MAETDLNDFRTRQFNTLSGGERSRVLLARALVAEPQVLLADEPVAALDLAHQIEVMSLLQ 183 Query: 183 ELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSV 237 +G V VLHDL A+ YC +L+++ G +A+G+PE V+T + F V Sbjct: 184 CYCQKGGAAVVVLHDLRLAAHYCHRLMLLVAGETLAEGSPESVLTGENMAHAFGV 238 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 259 Length adjustment: 24 Effective length of query: 231 Effective length of database: 235 Effective search space: 54285 Effective search space used: 54285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory