Align cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (EC 1.3.8.10) (characterized)
to candidate WP_029132326.1 A3GO_RS0104120 acyl-CoA dehydrogenase family protein
Query= BRENDA::Q39QF5 (380 letters) >NCBI__GCF_000428045.1:WP_029132326.1 Length = 394 Score = 154 bits (388), Expect = 5e-42 Identities = 102/288 (35%), Positives = 150/288 (52%), Gaps = 5/288 (1%) Query: 92 GMLPIIHGGSPELKERYLRR-FAGESTLLTALAATEPAAGSDLLAMKTRAVRQGDKYVIN 150 G PI GS + + YL GE L A A +EP AGSD+ A+ T A R+G +V++ Sbjct: 109 GTGPISIAGSAQQRADYLPPVMRGER--LAAFALSEPDAGSDVSAISTTARREGADFVLD 166 Query: 151 GQKCFITNGSVADVIVVYAYTDPEKGSKGISAFVVEKGTPGLVYGRNESKMGMRGSINSE 210 G K +I+NG +AD VV+A T G++G+SAF+V+ PG + + Sbjct: 167 GIKTWISNGGIADHYVVFARTGEAPGARGLSAFIVDADNPGFSVVERIRVIAPHPLATIK 226 Query: 211 LFFENMEVPAENIIGAEGTGFANLMQTLSTNRVFCAAQAVGIAQGALDIAVRHTQDRVQF 270 L EN VPA ++G G GF M TL R A A+G A+ L A+ Q+R F Sbjct: 227 L--ENCRVPASAMVGNPGEGFKVAMGTLDVFRTTVGAAALGFARRGLSEALARVQERSVF 284 Query: 271 GKPIAHLAPVQFMVADMATAVEASRLLTRKAAELLDDGDKKAVLYGSMAKTMASDTAMRV 330 GK ++ Q +A+MAT ++A+ LL ++A D + SMAK A++ A V Sbjct: 285 GKLLSEFQLTQAKIAEMATEIDAASLLVYRSAWSKDTFGGRNTAPSSMAKMYATEKAQEV 344 Query: 331 TTDAVQVLGGSGYMKENGVERMMRDAKLTQIYTGTNQITRMVTGRALL 378 AVQ+ GG G + VE + RD + +IY GT ++ ++V A+L Sbjct: 345 IDKAVQLFGGLGVVHGVPVESLYRDIRALRIYEGTTEVQKLVIANAVL 392 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 394 Length adjustment: 30 Effective length of query: 350 Effective length of database: 364 Effective search space: 127400 Effective search space used: 127400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory