Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_028584590.1 G494_RS0111035 2-hydroxyacid dehydrogenase
Query= BRENDA::O66939 (334 letters) >NCBI__GCF_000429965.1:WP_028584590.1 Length = 314 Score = 134 bits (336), Expect = 4e-36 Identities = 95/300 (31%), Positives = 156/300 (52%), Gaps = 24/300 (8%) Query: 25 LKIYTTDVSKVPENELKKAELISVFVYDKLTEELLSKMPRLKLIHTRSVGFDHIDLDYCK 84 L +Y SK + +AE++ V +LT LL PRL+L+ + G D++D + Sbjct: 26 LAVYQQTPSKEVAQRIAEAEVVIVNKV-RLTAALLRGAPRLRLVCLVATGTDNVDCAAAR 84 Query: 85 KKGILVTHIPAYSPESVAEHTFAMILTLVKRLKRIEDRVKKLNFSQDSEILAR-----EL 139 + GI V + AY +SV +H F MIL L L V + + Q S+ EL Sbjct: 85 ELGITVCNCQAYGTDSVVQHVFTMILALHTSLLPYTRAVAEGRWQQSSQFCLLDFPIVEL 144 Query: 140 NRLTLGVIGTGRIGSRVAMYGLAFGMKVLCYDVVKREDLKEKGCVYTSLDELLKESDVIS 199 TLG++G G +G VA AF M+VL + +R ++++G + L+ELL + D+++ Sbjct: 145 KGRTLGIMGYGTLGRGVARMAEAFEMEVL---LGERPGVRQEGRI--PLEELLPQVDILT 199 Query: 200 LHVPYTKETHHMINEERISLMKDGVYLINTARGKVVDTDALYRAYQRGKFSGLGLDVFED 259 LH P +++T ++I+ + LM+ +LIN ARG +V+ AL A +RG +G DV Sbjct: 200 LHCPLSEQTRNLIDARALELMRPSSFLINAARGGIVEEQALADALRRGTIAGAASDVLT- 258 Query: 260 EEILILKKYTEGKATDKNLKILELACKDNVIITPHIAYYTDKSLERIREETVKVVKAFVK 319 TE D L ++ N+I+TPH A+ + ++ RI +TV+ ++ FV+ Sbjct: 259 ---------TEPPGDDNPLLAADI---PNLIVTPHCAWGSYQARARIVAQTVENIEGFVR 306 Lambda K H 0.319 0.138 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 314 Length adjustment: 28 Effective length of query: 306 Effective length of database: 286 Effective search space: 87516 Effective search space used: 87516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory