Align D-lactate oxidase and glycolate oxidase, FAD-linked subunit (EC 1.1.3.15) (characterized)
to candidate WP_035245160.1 G494_RS0101860 FAD-linked oxidase C-terminal domain-containing protein
Query= reanno::psRCH2:GFF3772 (499 letters) >NCBI__GCF_000429965.1:WP_035245160.1 Length = 467 Score = 323 bits (827), Expect = 1e-92 Identities = 177/450 (39%), Positives = 262/450 (58%), Gaps = 2/450 (0%) Query: 22 LAELQAQLPDLDILHRSEDLKPYECDGLSAYRTTPLLVVLPERIEQVETLLKLCHQRGVP 81 + EL+A ++L ED+ Y D S P VV EQ+ L+K ++ +P Sbjct: 6 IKELEAIFSKENVLTAQEDMIAYSYDA-SHVEIRPEAVVFATTTEQISALMKFAYREHLP 64 Query: 82 VVARGAGTGLSGGALPLEQGILLVMARFNKILEVDPAGRFARVQPGVRNLAISQAAAPYE 141 V RG G+GLSGG++PL +GI+L M R +++E DPA R V+ G+ I A Sbjct: 65 VTPRGQGSGLSGGSVPLNRGIVLCMDRMKRVIEFDPANRLITVEAGLTTADIDPVAGEAN 124 Query: 142 LYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLLKVDILTVEGERMTLGSDALDS 201 L+Y PDP S +IGGNVAENAGG+ LKYG+T + + ++ +G+ +T+G+ + Sbjct: 125 LFYPPDPGSVAFSTIGGNVAENAGGLRGLKYGVTKDYVKMMKVVLPQGDIVTMGNKCVKH 184 Query: 202 -PGFDLLALFTGSEGMLGIVTEVTVKLLPKPQVAKVLLAAFDSVEKAGRAVGDIIAAGII 260 GF++ +F GSEG+LGI+TEVT+ LLP P+ + LA F+S++ A +AV DIIA+G+ Sbjct: 185 VAGFNMEGIFVGSEGLLGIMTEVTLALLPIPKHRESALAIFNSLDGAAQAVSDIIASGVT 244 Query: 261 PGGLEMMDNLSIRAAEDFIHAGYPVDAEAILLCELDGVEADVHDDCARVSEVLKLAGATE 320 P +E MDN +I A ++F G P DA A+LL E DG E + A+V +K E Sbjct: 245 PSTMEFMDNATINAIQNFKDCGLPRDAAAVLLIETDGEEHSAVFEMAQVEIQVKKNDIRE 304 Query: 321 VRLAKDEAERVRFWAGRKNAFPAVGRISPDYYCMDGTIPRRELPGVLKGISDLSEQFGLR 380 AK ER R + GR+ A A+ + P+ D T+ R LP +++GI+D+++Q+ L+ Sbjct: 305 FSRAKSSEERDRLFEGRRVALNALASVKPNLILEDATVMRSRLPEMVRGITDIAQQYQLQ 364 Query: 381 VANVFHAGDGNMHPLILFDANQPGELERAEDLGGKILELCVKVGGSITGEHGVGREKINQ 440 V HAGDGN+HP L D E+ R E + +L + + G+I+GEHG+G EK Sbjct: 365 VGIFGHAGDGNLHPTFLVDMRDKEEMARTEQGVTALFQLAIDLEGTISGEHGIGLEKKPF 424 Query: 441 MCSQFNADELTLFHAVKAAFDPSGLLNPGK 470 + +Q A+ + L +K FDP LLNPGK Sbjct: 425 LRNQIGAEGIRLLQDIKKTFDPLNLLNPGK 454 Lambda K H 0.320 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 534 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 467 Length adjustment: 34 Effective length of query: 465 Effective length of database: 433 Effective search space: 201345 Effective search space used: 201345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory