Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_028585877.1 G494_RS0119630 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000429965.1:WP_028585877.1 Length = 258 Score = 224 bits (571), Expect = 2e-63 Identities = 122/263 (46%), Positives = 173/263 (65%), Gaps = 9/263 (3%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 LL V+ L + F GL I +F +G I +LIGPNGAGKT+VFNC+TGFY+P G I F Sbjct: 3 LLHVQDLVLSFSGLKVIQGLNFSVAQGSIASLIGPNGAGKTSVFNCLTGFYRPDSGSIRF 62 Query: 74 NQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTIL 133 ++S +L + P IT++ +ARTFQN+RLF +TV EN++ H + + I Sbjct: 63 AERS----ILRKKPH-TITRQG-MARTFQNLRLFKSMTVEENVMSGLHCRTHAGALAAIF 116 Query: 134 GLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPELL 193 G +RE A +++ L+ ++D+ D A +LPYG QRR+E ARA+ T P+LL Sbjct: 117 QTPG---QRREEARVHRISQECLDFVGILDKKDWVAANLPYGDQRRVEWARALATKPKLL 173 Query: 194 CLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKISD 253 LDEPAAGLN E L L++ IR E +ILLIEHDM +VM++S+++ V++YGQKI++ Sbjct: 174 LLDEPAAGLNHNEKIELIELIRRIRDELDITILLIEHDMGLVMKVSENITVIDYGQKIAE 233 Query: 254 GTPDHVKNDPRVIAAYLGVEDEE 276 G+ D ++NDP+VI AYLG ED+E Sbjct: 234 GSADQIQNDPKVIEAYLGREDDE 256 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 258 Length adjustment: 25 Effective length of query: 267 Effective length of database: 233 Effective search space: 62211 Effective search space used: 62211 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory