GapMind for catabolism of small carbon sources

 

Protein WP_027178990.1 in Maridesulfovibrio bastinii DSM 16055

Annotation: NCBI__GCF_000429985.1:WP_027178990.1

Length: 372 amino acids

Source: GCF_000429985.1 in NCBI

Candidate for 62 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA hi spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 55% 95% 396.7 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 280.8
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 47% 78% 251.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 47% 78% 251.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 42% 81% 242.3 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 75% 235.7 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 75% 235.7 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 42% 81% 235.7 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 46% 75% 235.7 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 42% 81% 235.7 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 42% 81% 235.7 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 43% 78% 234.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 40% 88% 231.1 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 48% 71% 231.1 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 42% 82% 230.3 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-cellobiose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 87% 229.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-glucose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 87% 229.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
lactose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 87% 229.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 87% 229.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 87% 229.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
sucrose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 87% 229.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
sucrose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 87% 229.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
trehalose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 87% 229.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 76% 229.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 43% 80% 227.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 43% 80% 227.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 43% 80% 227.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 43% 80% 227.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 43% 80% 227.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 43% 80% 227.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 44% 77% 224.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 42% 75% 222.2 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 41% 84% 217.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 44% 72% 210.3 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 42% 80% 158.7 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 39% 95% 242.3 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 48% 67% 236.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 46% 68% 232.3 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 38% 91% 229.6 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 37% 99% 228.8 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 38% 89% 223.8 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 95% 219.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 95% 219.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 92% 214.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 92% 214.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 92% 214.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 92% 214.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 92% 214.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 46% 61% 214.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 92% 214.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 92% 214.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 37% 92% 214.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 39% 82% 214.2 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 39% 78% 204.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 39% 78% 204.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 39% 78% 204.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 39% 78% 204.5 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 96% 181.4 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 37% 77% 176.8 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 37% 63% 176.8 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 37% 81% 162.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 37% 81% 162.9 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 35% 66% 159.1 spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 55% 396.7

Sequence Analysis Tools

View WP_027178990.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MEKQQTIVELKGVSKVFDDQLALDNIDIGIRNGEFLTLLGPSGCGKTTLLRLIGGFESPS
SGSVIIDGVDVCGLPPEKRAVNTVFQSYALFPHMNVYDNVAFGLKLRKLQAKEIKRIVME
TLELVQMEKFSARMPYELSGGQQQRIAIARALVNQPLVLLLDEPFSALDRRLRKQMQLDM
KHLQRELGITFVLVTHDQEEAFTMSDRVVVMNNGNIEQTGSPREVYEEPENLFVAHFVGE
TNLFDASVVSVQGRRLTADFGDMVCSLTTDNRFSEGDRVKVLLRPEDMSLTSESEYEYEE
GLPVFMGTVFETVYKGTTYDVVVELDNGKTVLATEFFNEDAVNVSYRAGDRLAVSWIEGW
EVVLPDAPQDSV

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory