GapMind for catabolism of small carbon sources

 

Protein WP_034633096.1 in Maridesulfovibrio bastinii DSM 16055

Annotation: NCBI__GCF_000429985.1:WP_034633096.1

Length: 363 amino acids

Source: GCF_000429985.1 in NCBI

Candidate for 48 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 41% 88% 246.9 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 42% 87% 243.4 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 45% 78% 237.7 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 90% 230.7 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 90% 230.7 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 42% 84% 214.9 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 40% 84% 243.8 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 39% 92% 243 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 38% 97% 238.4 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 38% 97% 238.4 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 37% 99% 234.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 88% 232.6 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 88% 232.6 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 88% 232.6 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 88% 226.9 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 44% 66% 226.5 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 36% 95% 226.5 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 92% 219.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 92% 219.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 92% 219.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 92% 219.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 92% 219.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 92% 219.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 92% 219.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 39% 86% 218 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 35% 87% 218 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 45% 58% 214.9 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 36% 90% 214.5 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 37% 86% 213.8 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 90% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 90% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 90% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 90% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 90% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 90% 211.1 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 37% 91% 210.7 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 36% 83% 208 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 45% 62% 206.5 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 77% 206.1 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 40% 77% 203.8 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 62% 203 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 34% 98% 196.1 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 39% 59% 186.8 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 35% 78% 165.6 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 83% 165.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 83% 165.2 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 34% 83% 161.8 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 37% 81% 144.1 Uncharacterized ABC transporter ATP-binding protein YdcT 40% 250.8

Sequence Analysis Tools

View WP_034633096.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSSIGKVELSAVGKFYGPIEALHDIELTVEAGEYCCLLGPSGCGKSTAVRMISGHEEVTT
GDILLDGRNITDAPPAKRKTALMFQSYALFPHLSCLDNVAFSLKVAGVPKKSRRSQAMEL
LELVHMDEYAEALPDQLSGGQQQRVALARALITKPSVILLDEPLSALDPFLRIQMRKELK
KIQKELDMTFIHVTHSQEEAFALADKVVVMTKGTIQQIASPREVFESPNTPFVAGFIGGH
NIFSADFSLLNEGKFAVDMGGITPGRQCRYPELGKSGNYGFSVRADRIHLDAENSEDMDM
TLPATIALAEYQGSHVVVHCDAGTVEKIQIHIPDDRFFKLGLEPGQEVVLGWACRDMNIF
PPA

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory