Align scyllo-inosose 3-dehydrogenase; 2-keto-myo-inositol dehydrogenase; EC 1.1.1.- (characterized)
to candidate WP_027179346.1 G496_RS0111045 2,3-butanediol dehydrogenase
Query= SwissProt::Q9WYP3 (395 letters) >NCBI__GCF_000429985.1:WP_027179346.1 Length = 358 Score = 155 bits (392), Expect = 2e-42 Identities = 105/268 (39%), Positives = 138/268 (51%), Gaps = 30/268 (11%) Query: 29 WLGSKVWRYPEVRVEEVPEPRIEKPTEIIIKVKACGICGSDVHMAQTDEEGYILYPGLTG 88 W G K +VRVE VP P +P + +KV CGICGSD+H G I P Sbjct: 10 WHGQK-----DVRVETVPVPPFPEPGWVKVKVDWCGICGSDLHEYIA---GPIFIPTEAP 61 Query: 89 FPVT-------LGHEFSGVVVEAGPEAINRRTNKRFEIGEPVCAEEMLWCGHCRPCAEGF 141 P+T LGHEF+G +VE G N +G+ V + CG C C EG Sbjct: 62 HPLTGKQGSLILGHEFTGTIVEVGEGVTN------VSVGDFVAPDACQHCGECVTCREGR 115 Query: 142 PNHCENLNELGFNVDGAFAEYVKVDAKYAWSLRELEGVYEGDRLFLAGSLVEPTSVAYNA 201 N CE L G + DGAFA+YV + A+ + L E G+ + G+L+EP + + A Sbjct: 116 YNVCEKLAFTGLHNDGAFAKYVNIPAELCFVLPE--GISPEE-----GALIEPLATGFKA 168 Query: 202 VIVRGGGIRPGDNVVILGGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGADHVI 261 V R G G+NVVI+G G IGL + K AGA K+I+ E S VR AKE GAD VI Sbjct: 169 V--REAGSILGENVVIIGAGTIGLGTLMAAKAAGAGKIIMLEMSSVRTAKAKECGADVVI 226 Query: 262 DPTKENFVEAVLDYTNGLGAKLFLEATG 289 +P++ + V + TNG GA + E G Sbjct: 227 NPSEVDAVAEIKAMTNGSGADVSFECVG 254 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 358 Length adjustment: 30 Effective length of query: 365 Effective length of database: 328 Effective search space: 119720 Effective search space used: 119720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory