Align Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate WP_027178119.1 G496_RS0103835 ABC transporter ATP-binding protein
Query= TCDB::G4FGN3 (494 letters) >NCBI__GCF_000429985.1:WP_027178119.1 Length = 513 Score = 313 bits (803), Expect = 7e-90 Identities = 175/493 (35%), Positives = 297/493 (60%), Gaps = 6/493 (1%) Query: 3 PILEVKSIHKRFPGVHALKGVSMEFYPGEVHAIVGENGAGKSTLMKIIAGVYQPDEGEII 62 PI+ +K I KRF V A + ++ YPG + A++GENGAGKSTLM ++AG +QPDEG I Sbjct: 23 PIVSLKGITKRFGKVVANNKIVLDLYPGRIKALLGENGAGKSTLMSMLAGRFQPDEGHIE 82 Query: 63 YEGRGVRWNHPSEAINAGIVTVFQELSVMDNLSVAENIFMGDEEKRGIFIDYKKMYREAE 122 +G+ V ++ +AINAGI V+Q ++D+++V EN+ +G E G F++ K+M R + Sbjct: 83 VDGKRVDFSSSKDAINAGIGMVYQHFMLVDSMTVTENVLLGQE--GGFFVNPKEMSRRVK 140 Query: 123 KFMKEEFGIEIDPEEKLGKYSIAIQQMVEIARAVYKKAKVLILDEPTSSLTQKETEKLFE 182 K + E++ +EIDP+ ++ + S+ +Q VEI + +Y++++VLI DEPT+ LT +ET +LFE Sbjct: 141 K-LAEDYELEIDPDARINQLSMGEKQRVEILKLLYRESRVLIFDEPTAVLTPRETFRLFE 199 Query: 183 VVKSLKEKGVAIIFISHRLEEIFEICDKVSVLRDGEYIGTDSIENLT-KEKIVEMMVGRK 241 + ++ +G +I+FISH+LEE+ I D+V++LR G E +T K + MVG++ Sbjct: 200 ALWAMTRQGKSIVFISHKLEEVMAIADEVAILRRGCVDSEVPREKITSKADLACRMVGKE 259 Query: 242 LEKFYIKEAHEPGEVVLEVKNLSGERFENVSFSLRRGEILGFAGLVGAGRTELMETIFGF 301 + + E G+ VLEVK+L+G +N++ + RGE++G G+ G G+ L+E + G Sbjct: 260 VLLEIDRNEVEIGDKVLEVKSLNGLGLKNINIEVHRGEVVGIVGVAGNGQQALVEGVCGL 319 Query: 302 RPKRGGEIYIEGKRVEINHPLDAIEQGIGLVPEDRKKLGLILIMSIMHNVSLPSLDRIKK 361 R ++I GK + +PEDR L + ++ N+ L + Sbjct: 320 RMPPKDSVFIMGKAWREFFAKMTWNHSLSYIPEDRLDLATARELDLVDNLLLTTRQGFCS 379 Query: 362 GPFISFKREKELADWAIKTFDIRPAYPDRKVLYLSGGNQQKVVLAKWLALKPKILILDEP 421 GP + + E+A ++ D+RP LSGGN QK+VLA+ L +P +++ ++P Sbjct: 380 GPVLHRDKAAEVAKKLVEDHDVRPGRIQALAWQLSGGNLQKLVLARELYREPHLIVAEQP 439 Query: 422 TRGIDVGAKAEIYRIMSQLAKEGVGVIMISSELPEVLQMSDRIAVMSFGKLAGIIDAKEA 481 T+G+D+ A E++ + + A++ GV++++ +L E LQ+SDRIAVM G++ + Sbjct: 440 TQGLDISATEEVWNRLLE-ARKMAGVLLVTGDLNEALQLSDRIAVMYRGEIMDQFSVNDT 498 Query: 482 SQ-EKVMKLAAGL 493 + +KV + AG+ Sbjct: 499 EKVDKVGLMMAGV 511 Lambda K H 0.318 0.138 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 662 Number of extensions: 34 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 513 Length adjustment: 34 Effective length of query: 460 Effective length of database: 479 Effective search space: 220340 Effective search space used: 220340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory