Align D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_027178119.1 G496_RS0103835 ABC transporter ATP-binding protein
Query= uniprot:A0A1N7TX47 (495 letters) >NCBI__GCF_000429985.1:WP_027178119.1 Length = 513 Score = 236 bits (601), Expect = 2e-66 Identities = 152/474 (32%), Positives = 258/474 (54%), Gaps = 9/474 (1%) Query: 6 LLQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAGSILL 65 ++ + + K + V A L L G + AL G NGAGKST +S+L G Q D G I + Sbjct: 24 IVSLKGITKRFGKVVANNKIVLDLYPGRIKALLGENGAGKSTLMSMLAGRFQPDEGHIEV 83 Query: 66 NGAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCIVDNKALNRRTR 125 +G V F+ +A+ AGI M+ Q + MTV EN+ LG+E G V+ K ++RR + Sbjct: 84 DGKRVDFSSSKDAINAGIGMVYQHFMLVDSMTVTENVLLGQE---GGFFVNPKEMSRRVK 140 Query: 126 ELLDSLEFDVDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQTLFKA 185 +L + E ++D + +++LS+ + Q VEI K + +V+I DEPT+ + E LF+A Sbjct: 141 KLAEDYELEIDPDARINQLSMGEKQRVEILKLLYRESRVLIFDEPTAVLTPRETFRLFEA 200 Query: 186 IRRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAF-VESGRMADIDRDHLVRGIVGQE- 243 + +T QG IV++SH+L E+ IAD+ +I R G E R + L +VG+E Sbjct: 201 LWAMTRQGKSIVFISHKLEEVMAIADEVAILRRGCVDSEVPREKITSKADLACRMVGKEV 260 Query: 244 LTRIDHKVGRECAANTCLQVDNLSRAGEFHDISLQLRQGEILGIYGLMGSGRSEFLNCIY 303 L ID + L+V +L+ G +I++++ +GE++GI G+ G+G+ + + Sbjct: 261 LLEIDRNEVE--IGDKVLEVKSLNGLG-LKNINIEVHRGEVVGIVGVAGNGQQALVEGVC 317 Query: 304 GLTVADSGSVTLQGKPMPIGLPKATINAGMSLVTEDRKDSGLVLTGSILSNIALSAYKRL 363 GL + SV + GK K T N +S + EDR D ++ N+ L+ + Sbjct: 318 GLRMPPKDSVFIMGKAWREFFAKMTWNHSLSYIPEDRLDLATARELDLVDNLLLTTRQGF 377 Query: 364 SSWSLINARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVLAKCLSTEPVCLLCD 423 S +++ K ++A+ +V+ ++ ++ +SGGN QK+VLA+ L EP ++ + Sbjct: 378 CSGPVLHRDKAAEVAKKLVEDHDVRPGRIQALAWQLSGGNLQKLVLARELYREPHLIVAE 437 Query: 424 EPTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIAVFKGGRLV 477 +PT+G+D A +E+++ L + R ++V+ + E L LSDRIAV G ++ Sbjct: 438 QPTQGLDISATEEVWNRLLE-ARKMAGVLLVTGDLNEALQLSDRIAVMYRGEIM 490 Lambda K H 0.319 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 513 Length adjustment: 34 Effective length of query: 461 Effective length of database: 479 Effective search space: 220819 Effective search space used: 220819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory