Align Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale)
to candidate WP_027178119.1 G496_RS0103835 ABC transporter ATP-binding protein
Query= uniprot:Q9WXX0 (520 letters) >NCBI__GCF_000429985.1:WP_027178119.1 Length = 513 Score = 268 bits (686), Expect = 3e-76 Identities = 166/477 (34%), Positives = 262/477 (54%), Gaps = 12/477 (2%) Query: 14 ILKAKGIVKRFPGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEILV 73 I+ KGI KRF VVA + + ++Y I +L+GENGAGKSTL+ +L G +PD G I V Sbjct: 24 IVSLKGITKRFGKVVANNKIVLDLYPGRIKALLGENGAGKSTLMSMLAGRFQPDEGHIEV 83 Query: 74 NGERVEFHSPVDAFKKGISVIHQELNLCDNMTVAENIFLAYEAVRGQKRTLSSRVDENYM 133 +G+RV+F S DA GI +++Q L D+MTV EN+ L E V+ M Sbjct: 84 DGKRVDFSSSKDAINAGIGMVYQHFMLVDSMTVTENVLLGQEG--------GFFVNPKEM 135 Query: 134 YTRSKELLDLIGAKFSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTVEETE 193 R K+L + + PDA + L+ ++Q VEI K L +E R++ DEPT+ LT ET Sbjct: 136 SRRVKKLAEDYELEIDPDARINQLSMGEKQRVEILKLLYRESRVLIFDEPTAVLTPRETF 195 Query: 194 RLFEIIEMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDT-IIKMM 252 RLFE + + +G S+VF+SH+L+EVM I+D + ++R G E+ + + + M Sbjct: 196 RLFEALWAMTRQGKSIVFISHKLEEVMAIADEVAILRRGCVDSEVPREKITSKADLACRM 255 Query: 253 VGREVEFFPHGIETRPGEIALEVRNLKWKDKVKNVSFEVRKGEVLGFAGLVGAGRTETML 312 VG+EV E G+ LEV++L +KN++ EV +GEV+G G+ G G+ + Sbjct: 256 VGKEVLLEIDRNEVEIGDKVLEVKSLNGLG-LKNINIEVHRGEVVGIVGVAGNGQQALVE 314 Query: 313 LVFGVNQKESGDIYVNGRKVEIKNPEDAIKMGIGLIPEDRKLQGLVLRMTVKDNIVLPSL 372 V G+ +++ G+ + + IPEDR + + DN++L + Sbjct: 315 GVCGLRMPPKDSVFIMGKAWREFFAKMTWNHSLSYIPEDRLDLATARELDLVDNLLLTTR 374 Query: 373 KKISRWGLVLDERKEEEISEDYVKRLSIKTPSIYQITENLSGGNQQKVVLAKWLATNADI 432 + G VL K E+++ V+ ++ I + LSGGN QK+VLA+ L + Sbjct: 375 QGFCS-GPVLHRDKAAEVAKKLVEDHDVRPGRIQALAWQLSGGNLQKLVLARELYREPHL 433 Query: 433 LIFDEPTRGIDVGAKAEIHRMIRELAAQGKAVIMISSELPEILNLSDRIVVMWEGEI 489 ++ ++PT+G+D+ A E+ + E A + V++++ +L E L LSDRI VM+ GEI Sbjct: 434 IVAEQPTQGLDISATEEVWNRLLE-ARKMAGVLLVTGDLNEALQLSDRIAVMYRGEI 489 Lambda K H 0.319 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 631 Number of extensions: 37 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 513 Length adjustment: 35 Effective length of query: 485 Effective length of database: 478 Effective search space: 231830 Effective search space used: 231830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory