GapMind for catabolism of small carbon sources

 

Protein WP_029002228.1 in Azohydromonas australica DSM 1124

Annotation: NCBI__GCF_000430725.1:WP_029002228.1

Length: 281 amino acids

Source: GCF_000430725.1 in NCBI

Candidate for 29 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism gtsC hi Sugar ABC transporter permease (characterized, see rationale) 74% 96% 418.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 49% 299.3
D-glucose catabolism gtsC hi Sugar ABC transporter permease (characterized, see rationale) 74% 96% 418.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 49% 299.3
lactose catabolism gtsC hi Sugar ABC transporter permease (characterized, see rationale) 74% 96% 418.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 49% 299.3
D-maltose catabolism gtsC hi Sugar ABC transporter permease (characterized, see rationale) 74% 96% 418.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 49% 299.3
sucrose catabolism gtsC hi Sugar ABC transporter permease (characterized, see rationale) 74% 96% 418.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 49% 299.3
trehalose catabolism gtsC hi Sugar ABC transporter permease (characterized, see rationale) 74% 96% 418.3 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 49% 299.3
D-galactose catabolism PfGW456L13_1896 hi ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized) 63% 97% 344 ABC transporter for D-Cellobiose and D-Salicin, permease component 1 49% 299.3
D-xylose catabolism gtsC med ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized) 64% 97% 353.6 ABC transporter for D-Galactose and D-Glucose, permease component 2 63% 344.0
D-cellobiose catabolism SMc04257 med ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized) 49% 92% 299.3 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-mannose catabolism TT_C0326 med Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 50% 100% 274.6 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
L-arabinose catabolism xacI lo Xylose/arabinose import permease protein XacI (characterized, see rationale) 32% 94% 155.2 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
N-acetyl-D-glucosamine catabolism ngcG lo NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized) 32% 85% 149.8 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-glucosamine (chitosamine) catabolism ngcG lo NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized) 32% 85% 149.8 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
L-arabinose catabolism araU lo AraU, component of Arabinose, fructose, xylose porter (characterized) 31% 92% 144.1 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-fructose catabolism araU lo AraU, component of Arabinose, fructose, xylose porter (characterized) 31% 92% 144.1 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
sucrose catabolism araU lo AraU, component of Arabinose, fructose, xylose porter (characterized) 31% 92% 144.1 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-xylose catabolism araU lo AraU, component of Arabinose, fructose, xylose porter (characterized) 31% 92% 144.1 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-maltose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 34% 67% 137.5 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
sucrose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 34% 67% 137.5 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
trehalose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 34% 67% 137.5 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-cellobiose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 56% 125.2 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-glucose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 56% 125.2 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
lactose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 56% 125.2 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-maltose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 56% 125.2 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
sucrose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 56% 125.2 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
trehalose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 56% 125.2 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-cellobiose catabolism msdB2 lo Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) 30% 92% 124.8 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-cellobiose catabolism cebG lo CBP protein aka CebG, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 30% 96% 115.9 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7
D-maltose catabolism thuG lo Putative maltose permease, component of MalEFG (K unknown), involved in maltose and maltodextrin uptake (characterized) 31% 70% 104 GtsC (GLcG), component of Glucose porter, GtsABCD 66% 356.7

Sequence Analysis Tools

View WP_029002228.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MKLHRLVLWTALALFAAWFLAPLYVMLVTSLKDMEQIRTGHLLSLPTSPSLEAWSRAWSS
ACTGTDCNGLRPFFLNSVLLVVPAVLISTAIGALNGYVLSKWRFRGSELMFALMLFGVFM
PMQVVLLPMSQVLGWLGLASSISGLVLVHVLAGLPSTTLFFRNYYVGLPDELVKAAMLDG
ASFWQIFRRIVLPLSTPILVVTLIWQFTQIWNDFLYGVVFSGADSKPITVGLNNLVNTSS
SVKEYNVDMAAALIAALPTLLVYVIAGKYFVRGLTAGAVKG

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory