GapMind for catabolism of small carbon sources

 

Protein WP_043458116.1 in Azohydromonas australica DSM 1124

Annotation: NCBI__GCF_000430725.1:WP_043458116.1

Length: 331 amino acids

Source: GCF_000430725.1 in NCBI

Candidate for 35 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 41% 91% 225.7 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 43% 80% 218.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 83% 216.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 83% 216.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
lactose catabolism lacK med LacK, component of Lactose porter (characterized) 42% 79% 210.3 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 45% 62% 220.7 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 69% 218.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 47% 65% 217.6 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 47% 65% 217.6 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 49% 64% 215.7 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-cellobiose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 40% 82% 211.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-glucose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 40% 82% 211.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
lactose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 40% 82% 211.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-maltose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 40% 82% 211.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
sucrose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 40% 82% 211.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
trehalose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 40% 82% 211.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 40% 82% 211.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 90% 211.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 47% 63% 208 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 46% 62% 206.8 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 80% 206.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 80% 206.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 79% 191.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 79% 191.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 79% 191.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 79% 191.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 79% 191.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 79% 191.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 79% 191.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 79% 191.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 79% 191.4 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 35% 68% 171 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 39% 72% 169.1 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 36% 84% 157.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 36% 84% 157.5 Uncharacterized ABC transporter ATP-binding protein YdcT 44% 241.5

Sequence Analysis Tools

View WP_043458116.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSTDLAHLELVALSKRYGPGTPAVDAIDLQVRAGSYCCLLGPSGCGKTTTLRMIAGHEVA
TEGDILLGARNITDLDATQRGTAMMFQSYALFPHLNALDNVAFGLKMRGVDAATRRARAA
ELLDLVAMGAYAQRKPGELSGGQQQRVALARALITNPKVLLLDEPLSALDPFLRVKMRAE
LKRWQKDLGFSFVHVTHSQEEAMALADQVVVMNAGRIEQQGTPHQIFNAPRTEFVARFMG
GHNVLPAGSAKVAVRSDRTLLTRGAASAGEGLAATVQNVEYQGTYVLVTLASNAGEVAAM
LPEGAFDVAPWAPGEAATVSWLPAHAHALQA

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory