GapMind for catabolism of small carbon sources

 

Protein WP_211235097.1 in Azohydromonas australica DSM 1124

Annotation: NCBI__GCF_000430725.1:WP_211235097.1

Length: 222 amino acids

Source: GCF_000430725.1 in NCBI

Candidate for 17 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism aatM hi ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 (characterized) 50% 100% 211.5 ABC transporter for D-Alanine, permease component 1 33% 129.8
L-aspartate catabolism aatM hi ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 (characterized) 50% 100% 211.5 ABC transporter for D-Alanine, permease component 1 33% 129.8
L-glutamate catabolism gltK hi ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 (characterized) 50% 100% 211.5 ABC transporter for D-Alanine, permease component 1 33% 129.8
D-alanine catabolism Pf6N2E2_5404 lo ABC transporter for D-Alanine, permease component 1 (characterized) 33% 58% 129.8 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
D-glucosamine (chitosamine) catabolism AO353_21720 lo ABC transporter for D-Glucosamine, permease component 1 (characterized) 32% 90% 123.6 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-asparagine catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 32% 60% 120.9 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-aspartate catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 32% 60% 120.9 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-asparagine catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 32% 95% 117.1 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-aspartate catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 32% 95% 117.1 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-citrulline catabolism PS417_17595 lo ABC transporter permease subunit; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine transport system permease protein (characterized, see rationale) 34% 95% 113.2 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-glutamate catabolism gluD lo GluD aka CGL1953, component of Glutamate porter (characterized) 31% 78% 110.9 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-asparagine catabolism aatQ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 31% 89% 110.5 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-aspartate catabolism aatQ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 31% 89% 110.5 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-glutamate catabolism gltJ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 31% 89% 110.5 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-lysine catabolism hisQ lo ABC transporter for L-Lysine, permease component 1 (characterized) 31% 95% 108.6 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-asparagine catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 30% 54% 81.3 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5
L-aspartate catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 30% 54% 81.3 ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 50% 211.5

Sequence Analysis Tools

View WP_211235097.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLNLDFSFLSWDVVTGFVLKGLLFSLQLTLVAMIGGIVIGTLLALMRLSGRKWLVVPAQL
YVDTLRSIPLVMVILWFFLLIPLLTGRPLGAEISAMITFTVFEAAYYSEIMRAGIQSVPR
GQVYAGYAMGMSYKQTMQLVVLPQAFRNMLPVLLTQTIILFQDTSLVYAIGAYDLLKGFE
VAGKNFNRPVETYLVAAVVYFVICFSLSLLVKRLQKKVAIIR

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory