Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (characterized)
to candidate WP_028997934.1 H537_RS0110835 3-hydroxybutyryl-CoA dehydrogenase
Query= BRENDA::Q0KEY8 (284 letters) >NCBI__GCF_000430725.1:WP_028997934.1 Length = 283 Score = 389 bits (998), Expect = e-113 Identities = 197/283 (69%), Positives = 229/283 (80%) Query: 1 MSIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLT 60 M I +GI+GAGTMGNGIAQ CAV GL VVMVDISD AV+ GV T+A SLDRL+KKEKLT Sbjct: 1 MKINRIGIIGAGTMGNGIAQVCAVAGLQVVMVDISDEAVRLGVKTLAGSLDRLVKKEKLT 60 Query: 61 EADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSS 120 A K AL R++GST Y L+ IVIEAATEN DLK++IL+Q++ IV +IASNTSS Sbjct: 61 PAQKDEALVRVQGSTDYAALRDAQIVIEAATENPDLKLRILRQVEAIVRHEAVIASNTSS 120 Query: 121 ISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPIT 180 ISIT+LAAV + +R IGMHFFNPVP+M L+ELIRGLQTSD THA A ++ +GK P+T Sbjct: 121 ISITQLAAVLDKPERCIGMHFFNPVPLMGLLELIRGLQTSDETHALAAAFAQAVGKTPVT 180 Query: 181 VKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTM 240 VKNSPGFVVNRILCPMINEA VL EGLA+ E+ID GMKLGCNHPIGPLALAD+IGLDTM Sbjct: 181 VKNSPGFVVNRILCPMINEAIFVLQEGLATAEDIDAGMKLGCNHPIGPLALADLIGLDTM 240 Query: 241 LAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVYS 283 L++MEV + F D KYRPA L+REMV AG LGRK+GRG Y Y+ Sbjct: 241 LSIMEVFHEGFGDTKYRPAPLLREMVQAGRLGRKSGRGFYSYA 283 Lambda K H 0.319 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 283 Length adjustment: 26 Effective length of query: 258 Effective length of database: 257 Effective search space: 66306 Effective search space used: 66306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory