Align ABC transporter for D-Alanine, permease component 2 (characterized)
to candidate WP_028997580.1 H537_RS0108530 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5403 (375 letters) >NCBI__GCF_000430725.1:WP_028997580.1 Length = 250 Score = 84.7 bits (208), Expect = 2e-21 Identities = 72/235 (30%), Positives = 113/235 (48%), Gaps = 31/235 (13%) Query: 147 FVSSRGLNMPAALVAEGFWPFVISVVLAIVAIVL--------MTRWANKRFEATGEPFHK 198 F+S + + ALVA G V+ +L +V+ + R K A + Sbjct: 15 FLSGLWMTVQLALVAVGAG-LVLGALLGLVSSSADAPEPKAPLLRVLMKLARAVTLGYVT 73 Query: 199 FWVGLALFLVIPALSALLFGAPVHWEMPELKGFNFVGGWVLIPE-----------LLALT 247 F+ G LF+ I + L +H E GW+L E + Sbjct: 74 FFRGTPLFVQILLVHFALMPTLIHPET----------GWLLTGEAAREFRQEHGAFFSGA 123 Query: 248 LALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVIIPQALRVIIPPLTSQ 307 LALT+ A+I+EI R+GI+S+ GQT+AA SLGL + +R VI+PQA R ++P L ++ Sbjct: 124 LALTLNAGAYISEIFRAGIQSIHRGQTQAAYSLGLTHAQAMRDVILPQAFRRMVPALVNE 183 Query: 308 YLNLAKNSSLAAGIGYPEMVSLFAGTVLNQTGQAIEVIAITMSVYLAISISISLL 362 + L K+SSL + IG E+ +L A TV + E ++YL +++ +S L Sbjct: 184 GVTLIKDSSLVSAIGLAEL-ALAARTVAGAYSRYWEPYLAISALYLVLTLLLSTL 237 Score = 33.9 bits (76), Expect = 5e-06 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 13/88 (14%) Query: 62 YARVFLIGLLNTLLVTFIGVILATILGFIIGVARLSQN---------WIISKLATV---- 108 Y +FL GL T+ + + V +LG ++G+ S + ++ KLA Sbjct: 11 YGPLFLSGLWMTVQLALVAVGAGLVLGALLGLVSSSADAPEPKAPLLRVLMKLARAVTLG 70 Query: 109 YVEVFRNIPPLLQILFWYFAVFLSMPGP 136 YV FR P +QIL +FA+ ++ P Sbjct: 71 YVTFFRGTPLFVQILLVHFALMPTLIHP 98 Lambda K H 0.328 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 375 Length of database: 250 Length adjustment: 27 Effective length of query: 348 Effective length of database: 223 Effective search space: 77604 Effective search space used: 77604 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory