Align aerobic C4-dicarboxylate transport protein (characterized)
to candidate WP_028999586.1 H537_RS0122110 dicarboxylate/amino acid:cation symporter
Query= CharProtDB::CH_014038 (428 letters) >NCBI__GCF_000430725.1:WP_028999586.1 Length = 393 Score = 530 bits (1366), Expect = e-155 Identities = 270/367 (73%), Positives = 315/367 (85%) Query: 49 IAPVIFCTVVTGIAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVD 108 IAP+IFCTVV GIAGME MK VG+TG +ALLYFEIVSTIAL++GL+I+N+V+PGAGMNVD Sbjct: 1 IAPIIFCTVVVGIAGMEDMKKVGKTGGLALLYFEIVSTIALLVGLVIINLVKPGAGMNVD 60 Query: 109 PATLDAKAVAVYADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLG 168 + LD K++A Y Q F+++VIP++V+ AFA G ILQVLLFAV+FGFALH+ G Sbjct: 61 VSQLDTKSLAAYTKPGAMQSTTDFLLNVIPSTVVDAFAKGEILQVLLFAVMFGFALHKFG 120 Query: 169 SKGQLIFNVIESFSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYI 228 +G L+F+ IE FS V+F I+ IM++APIGAFGAMAFTIGKYGVG+LVQLGQL+ FY Sbjct: 121 GRGTLVFDFIEKFSHVLFSIVGYIMKVAPIGAFGAMAFTIGKYGVGSLVQLGQLMATFYA 180 Query: 229 TCILFVVLVLGSIAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKS 288 TC+LF+ +VLG+IA+A+GFSI KFI+YI+EELLIVLGTSSSES LPRM+ KME LG RKS Sbjct: 181 TCLLFIFVVLGTIARASGFSILKFIKYIKEELLIVLGTSSSESVLPRMMAKMENLGARKS 240 Query: 289 VVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTG 348 VVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATN+ M I QITLL VLLL+SKGAAGVTG Sbjct: 241 VVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNTDMTISQQITLLAVLLLTSKGAAGVTG 300 Query: 349 SGFIVLAATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHK 408 SGFIVLAATLSAVGH+PVAGLALILGIDRFMSEARALTNL+GNGVAT+VVAK +LD Sbjct: 301 SGFIVLAATLSAVGHVPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKMTGDLDSD 360 Query: 409 KLDDVLN 415 +L LN Sbjct: 361 RLRRTLN 367 Lambda K H 0.327 0.142 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 558 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 393 Length adjustment: 31 Effective length of query: 397 Effective length of database: 362 Effective search space: 143714 Effective search space used: 143714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory