Align PP1069, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_028997580.1 H537_RS0108530 amino acid ABC transporter permease
Query= TCDB::Q88NY4 (223 letters) >NCBI__GCF_000430725.1:WP_028997580.1 Length = 250 Score = 120 bits (300), Expect = 3e-32 Identities = 82/230 (35%), Positives = 124/230 (53%), Gaps = 24/230 (10%) Query: 13 PALWEGMVMTLKLMVMGVIGGIVLGTILALMRLSSS---------KLLSNLAGA----YV 59 P G+ MT++L ++ V G+VLG +L L+ S+ ++L LA A YV Sbjct: 13 PLFLSGLWMTVQLALVAVGAGLVLGALLGLVSSSADAPEPKAPLLRVLMKLARAVTLGYV 72 Query: 60 NYFRSIPLLLVITWFYLAV-PFVLR----WI-TGEDTPV-----GAFTSCVVAFMMFEAA 108 +FR PL + I + A+ P ++ W+ TGE GAF S +A + A Sbjct: 73 TFFRGTPLFVQILLVHFALMPTLIHPETGWLLTGEAAREFRQEHGAFFSGALALTLNAGA 132 Query: 109 YFCEIVRAGVQSISKGQMGAAQALGMNYAQTMRLIILPQAFRKMTPLLLQQSIILFQDTS 168 Y EI RAG+QSI +GQ AA +LG+ +AQ MR +ILPQAFR+M P L+ + + L +D+S Sbjct: 133 YISEIFRAGIQSIHRGQTQAAYSLGLTHAQAMRDVILPQAFRRMVPALVNEGVTLIKDSS 192 Query: 169 LVYTVGLVDFLNSARSNGDIIGRSHEFLIFAGVVYFLISFSASWLVKRLQ 218 LV +GL + +AR+ R E + +Y +++ S L KRL+ Sbjct: 193 LVSAIGLAELALAARTVAGAYSRYWEPYLAISALYLVLTLLLSTLAKRLE 242 Lambda K H 0.330 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 250 Length adjustment: 23 Effective length of query: 200 Effective length of database: 227 Effective search space: 45400 Effective search space used: 45400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory