Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate WP_211235097.1 H537_RS0128685 amino acid ABC transporter permease
Query= uniprot:Q31RP0 (377 letters) >NCBI__GCF_000430725.1:WP_211235097.1 Length = 222 Score = 78.2 bits (191), Expect = 2e-19 Identities = 58/194 (29%), Positives = 101/194 (52%), Gaps = 5/194 (2%) Query: 180 LVVILAIALVLFVSWLAQRQRSPRDWRWLYGAIAVVTV--LMLLTQLSWPQQLQPGQIRG 237 L ++ I ++ + LA + S R W + + V T+ + L+ + W L P + Sbjct: 28 LTLVAMIGGIVIGTLLALMRLSGRKWLVVPAQLYVDTLRSIPLVMVILWFFLLIP--LLT 85 Query: 238 GLRLSLEFTALLLGLVAYTGAFITEIIRGGILSVPAGQWEAAAALGLTRSQTLWQIVVPQ 297 G L E +A++ V + A+ +EI+R GI SVP GQ A A+G++ QT+ +V+PQ Sbjct: 86 GRPLGAEISAMITFTV-FEAAYYSEIMRAGIQSVPRGQVYAGYAMGMSYKQTMQLVVLPQ 144 Query: 298 ALRVIVPSLNSQYVGFAKNSSLAIAVGYPDLYATAQTTLNQTGRPVEVFLILMLTYLAIN 357 A R ++P L +Q + +++SL A+G DL + RPVE +L+ + Y I Sbjct: 145 AFRNMLPVLLTQTIILFQDTSLVYAIGAYDLLKGFEVAGKNFNRPVETYLVAAVVYFVIC 204 Query: 358 AVISAGMNGLQQRL 371 +S + LQ+++ Sbjct: 205 FSLSLLVKRLQKKV 218 Score = 33.9 bits (76), Expect = 4e-06 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Query: 85 GLVNSLRVIAIGLILTTVIGTLAGVAAFSENWLLRQLSRGYVAVVRNTPLLLQLIVWYF- 143 GL+ SL++ + +I VIGTL + S L ++ YV +R+ PL++ +I+W+F Sbjct: 21 GLLFSLQLTLVAMIGGIVIGTLLALMRLSGRKWLVVPAQLYVDTLRSIPLVM-VILWFFL 79 Query: 144 --PILLSLP 150 P+L P Sbjct: 80 LIPLLTGRP 88 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 222 Length adjustment: 26 Effective length of query: 351 Effective length of database: 196 Effective search space: 68796 Effective search space used: 68796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory