Align 2-deoxy-D-ribonate transporter 1 (characterized)
to candidate WP_028999949.1 H537_RS0124480 MFS transporter
Query= reanno::Koxy:BWI76_RS23715 (445 letters) >NCBI__GCF_000430725.1:WP_028999949.1 Length = 442 Score = 291 bits (746), Expect = 2e-83 Identities = 159/423 (37%), Positives = 240/423 (56%), Gaps = 7/423 (1%) Query: 8 AVNGTQLQRTHKKIYRHLMPLLIVAYIISFIDRTNIGMAKATMSVDIGLSATAFGLGAGL 67 AV + +KI L+P+L V+Y +F+DR N+G A+ M ++G S +GLGAG+ Sbjct: 7 AVGEAETNAVLRKISGRLLPILFVSYFFAFLDRINVGYAQLQMKAELGFSDAVYGLGAGI 66 Query: 68 FFLTYAVLEIPSNLFLTRIGARRWIARIMITWGIISCGMAFVTGPTSFYVMRLLLGAAEA 127 FF++Y + E+PSNL+L RIGAR + RIM+ WG+ S V PT FY++R LLGA EA Sbjct: 67 FFISYLLFEVPSNLWLQRIGARLTLLRIMLLWGVTSAATMLVRTPTEFYIVRFLLGAFEA 126 Query: 128 GLYPGIIYYLTLWFGREERAKATGLFLLGVCLANIIGAPLGGLLL-SLDGMSGWHGWQWM 186 G +PGII YLT WF RA TG F+ V +A ++G P+ GL++ S+ G++G GW+W+ Sbjct: 127 GFFPGIILYLTYWFPSTYRASVTGKFMFAVPMAGMVGGPVSGLIMGSMQGVAGLSGWEWL 186 Query: 187 FFIEGLPAIALAFVVWRRLPDKPADARWLDSHDVQAITAVLEKE--AEETRHTPSRFSLK 244 F IE LP + L + + L +KPADA WL + + A L+++ E H S+ Sbjct: 187 FVIEALPTLVLGVICFVYLDNKPADADWLTQREKDVVQAALDRDHAGEAEMHGTKNSSIT 246 Query: 245 TALTTRVFLLLVLIYFTHQFSVYGLSYFLPGIIGSWGQLTPLQIGLLTAIPWIAAAAGGI 304 AL LL LIYF + Y ++++P II S G IG L+AIP+ A AA G+ Sbjct: 247 AALFDARVWLLALIYFATACANYTYTFWIPTIIKSLGVSDVASIGWLSAIPY-AFAAAGV 305 Query: 305 LLPRFARTEQRSRSMLMAGYLVMAT-GMAIGAIAGHGVALLGFSLAAFMFFAMQSIIFNW 363 L+ + + R + G L++A G+A + L L+A F + I W Sbjct: 306 LVITASSDRLKERRWHVGGTLILAAIGLAFSTTLQSSLTLSLLVLSAVAFVQFGAAITFW 365 Query: 364 L--PSIMSGHMLAGSFGLLNCLGLCGGFLGPFILGAFEDRTGAATSGLWFAVALLIVGAL 421 P+ +S A GL++ +G+ GGF+ P +LG ++ TG+ G++F A+++VG L Sbjct: 366 AIPPTYLSRETAAVGIGLVSSIGVVGGFVSPALLGYIKNETGSLAYGIYFIAAVMVVGGL 425 Query: 422 ASL 424 +L Sbjct: 426 LTL 428 Lambda K H 0.328 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 442 Length adjustment: 32 Effective length of query: 413 Effective length of database: 410 Effective search space: 169330 Effective search space used: 169330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory