Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_028997414.1 H537_RS0107560 2-hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000430725.1:WP_028997414.1 Length = 317 Score = 179 bits (455), Expect = 6e-50 Identities = 116/291 (39%), Positives = 158/291 (54%), Gaps = 23/291 (7%) Query: 13 DVLAYLQQHAQVVQVDATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVG 72 D AYL +H FVAA+ A GI + A++E +L+ +S+ VG Sbjct: 36 DARAYLAEHGA----------GFVAAVTSAAVGIDA------ALIESLPKLQVISSFGVG 79 Query: 73 FDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGP 132 D+ D+ RRGI + TP+VL + ADT F+L+L ARR E +V+ G W P Sbjct: 80 LDKIDLQAAARRGIPVGYTPEVLNDCVADTAFTLLLDVARRATEADRFVRQGGWLKDKFP 139 Query: 133 ALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAE 192 V GK LGIVGLGRIG +ARRA+ GF+M++ Y NR Y VELA Sbjct: 140 --LATRVSGKRLGIVGLGRIGRTIARRAS-GFDMEIRYHNRRPAEGVSFGYEPSLVELAR 196 Query: 193 LLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIH 252 +DF+ + E+++L+ A L ++ L+N +RG VDE L++ LQ I Sbjct: 197 ---WSDFLVIAAAGGAESRNLVSAEVLDALGPQGFLVNIARGTVVDEAVLVQYLQEKRIA 253 Query: 253 GAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAAENLVA 303 GAGLDV+ EP ++ LL+L N V LPH+ SATHETR AM+ ENL A Sbjct: 254 GAGLDVYVDEPRVPEA-LLQLDNAVLLPHVASATHETRQAMSELVLENLRA 303 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 317 Length adjustment: 28 Effective length of query: 293 Effective length of database: 289 Effective search space: 84677 Effective search space used: 84677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory