Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_028311694.1 H566_RS0112420 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_000482785.1:WP_028311694.1 Length = 398 Score = 265 bits (676), Expect = 2e-75 Identities = 160/399 (40%), Positives = 226/399 (56%), Gaps = 10/399 (2%) Query: 1 MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRA-GIDPKEVEDVVMGAAMQ 59 + +A +V+ RTP+ + GA LL HA+ V RA G+DP E+ DV++G AM Sbjct: 5 LQDAYLVAAVRTPVARR-NGAFRHARPDDLLAHALRELVARAPGLDPAEIADVIVGCAMP 63 Query: 60 QGATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGES 119 + G N+AR LL AGLP + G T++R CASGLQA+A AA + E+ + G ES Sbjct: 64 EAEQGMNVARIGLLLAGLPASVPGFTVNRFCASGLQAVADAAARIRSGEAEVMIAAGVES 123 Query: 120 ISLVQNDKMNTFHAVDPALEAIKGDVYMA----MLDTAETVAKRYGISRERQDEYSLESQ 175 ++++ N V P + D + A M TAE VA+R+ +SR QD +++ES Sbjct: 124 MTVMTKMMGNR---VRPNPAFFEHDEHRAIAWGMGLTAEEVARRWNVSRAEQDAFAVESH 180 Query: 176 RRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLAGLKA 235 +R AA G+F DEIAP T + G ++ DEGPR + + E + L+ Sbjct: 181 KRAIAAIDAGRFADEIAPYITT-SARPGSDGQPLRTTSVVTHDEGPRRDASPERIGALRP 239 Query: 236 VRGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCEPDEMGIGPV 295 V ++TAGNASQ+SDGA+A ++MS+ GL+P+ F G P+ MGIGPV Sbjct: 240 VFAADGSVTAGNASQMSDGAAAVLLMSEVALKRSGLQPIARFVAHAVAGVPPEVMGIGPV 299 Query: 296 FAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISVGHPYGMS 355 A+PR L R G D + ELNEAFA Q + R LG+DP ++N GGAI++GHP G + Sbjct: 300 EAIPRALARAGWRQDSLDWIELNEAFAAQAIAVRRTLGLDPAQINPLGGAIALGHPLGAT 359 Query: 356 GARLAGHALIEGRRRKAKYAVVTMCVGGGMGSAGLFEIV 394 GA L +R A+ +VTMC+G GMG+AG+ E V Sbjct: 360 GAIRTATLLAAMKRGDARRGMVTMCIGTGMGAAGVIERV 398 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 398 Length adjustment: 31 Effective length of query: 364 Effective length of database: 367 Effective search space: 133588 Effective search space used: 133588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory