Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_028311438.1 H566_RS0110655 glucose 1-dehydrogenase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_000482785.1:WP_028311438.1 Length = 269 Score = 116 bits (291), Expect = 4e-31 Identities = 83/260 (31%), Positives = 118/260 (45%), Gaps = 22/260 (8%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALA----VFRDKYPGTVATRADVS 67 G V+++G + GIG LA AGA+V + S LA +A DV+ Sbjct: 16 GKVVMVTGASRGIGRTLALGLAAAGARVGLAARSADGLAETAAAIETAGGSCLAVTLDVT 75 Query: 68 DAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHH 127 D A + F E GG D LVNNAG +D + +A W ++ NL A + A Sbjct: 76 DHAAVAGAFARVAERFGGFDALVNNAGAEQVCASLD-VDEAIWDRIVDTNLKAPFFCAQA 134 Query: 128 AVPMLKESSH--------GHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGES 179 A ++ E S G +++I SVA LG PY A+K ++GL ++LA+E Sbjct: 135 AARLMLERSPANADAGCAGSIVNIGSVASMLGIPTAVPYCASKHGVLGLTRALAAEWAPL 194 Query: 180 DIRVNALLPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALF 239 +RVNA+ PG D A Q + L KI R +D+A A+F Sbjct: 195 GLRVNAIGPGYFRTAMTDAFYEAPGWQAAM---------LPKIPAGRFGRLDDLAGAAVF 245 Query: 240 LCSPAARNVTGQAISVDGNV 259 LC AR + GQ + VDG + Sbjct: 246 LCGDGARYINGQILYVDGGL 265 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 269 Length adjustment: 25 Effective length of query: 237 Effective length of database: 244 Effective search space: 57828 Effective search space used: 57828 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory