Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_028310213.1 H566_RS0102680 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >NCBI__GCF_000482785.1:WP_028310213.1 Length = 309 Score = 264 bits (674), Expect = 2e-75 Identities = 145/302 (48%), Positives = 197/302 (65%), Gaps = 9/302 (2%) Query: 1 MEYFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSI 60 ME +QQL+NGL LGS+Y L+A+GYTMVYGI+ +INFAHGD+ M+G AL L Sbjct: 1 MEILLQQLINGLVLGSVYALIALGYTMVYGILQLINFAHGDVLMVGALTALSTSKFLQEA 60 Query: 61 FAGLPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQ 120 +P ++LL+ L A+++ L N IERVAYRPLR + RLAPLITAIGMSITL Sbjct: 61 APWMPGPLVLLIALAAAIVVCVLVNIGIERVAYRPLRNAPRLAPLITAIGMSITLQTLAM 120 Query: 121 VTQGPRNKPIPPMVSSV-YQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQRAT 179 + P ++ + G S++ Q+II++++ L+ +VN+T LGRA RAT Sbjct: 121 LIWSRNYMVFPALLPNAPMPLGGASITPVQVIIVLLSLALMVGLVLLVNKTKLGRAMRAT 180 Query: 180 EQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFTAAV 239 ++ ++AAL+GV+ D+ I ITF +GAALAAVAG M Y +A F GF PG+KAFTAAV Sbjct: 181 AENPRVAALMGVDPDRVIVITFALGAALAAVAGVMIAANYSIAHFYMGFLPGLKAFTAAV 240 Query: 240 LGGIGSLPGAVFGGLLIGLIESLWSAY--------FTIAYKDVATFAILAFVLIFKPTGI 291 LGGIG+L GA+ GGLL+GLIE+L + Y Y+D+ F +L VL +P+GI Sbjct: 241 LGGIGNLYGAMVGGLLLGLIEALGAGYIGDLTGGVLGSNYQDIFAFIVLIIVLTLRPSGI 300 Query: 292 LG 293 +G Sbjct: 301 MG 302 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 309 Length adjustment: 27 Effective length of query: 273 Effective length of database: 282 Effective search space: 76986 Effective search space used: 76986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory