Align BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC (characterized)
to candidate WP_028312377.1 H566_RS0117030 branched-chain amino acid ABC transporter substrate-binding protein
Query= TCDB::Q9L3M3 (381 letters) >NCBI__GCF_000482785.1:WP_028312377.1 Length = 380 Score = 197 bits (502), Expect = 3e-55 Identities = 126/357 (35%), Positives = 182/357 (50%), Gaps = 12/357 (3%) Query: 14 MLAFSGNAWADVLIAVAG---PLTGPNAAFGAQLQKGAEQAAADINAAG-GINGEQIKIE 69 +LA + NA A + G P++G A G + GA+ A D+N AG I G++ K Sbjct: 14 VLAVASNAEAQEAVIKIGHVAPMSGGQAHLGKDNEAGAKLAIEDLNKAGITIGGKKAKFV 73 Query: 70 L--GDDVSDPKQGISVANKFAADGVKFVIGHFNSGVSIPASEVYAENGILRNHPGRDEPD 127 L DD +DP+QG +VA K V V+GH NSG SIPAS++Y + GI + P P Sbjct: 74 LVSEDDGADPRQGTAVAQKLVDAKVVGVVGHLNSGTSIPASKIYYDAGIPQISPSSTAPK 133 Query: 128 LHGTGLWNTFRTCGRDDQQGAIAGKYLADHFKDAKIAVVHDKTPYGQGLADETKKAMNAA 187 G TFR D Q GA G+Y K K+AV+ D+T YGQG+ADE KA AA Sbjct: 134 YTQQGFNTTFRVVANDSQLGARLGQYAVSQLKAKKVAVIDDRTAYGQGVADEFSKAAKAA 193 Query: 188 GVTEVIYEGINVGDKDFSALIAKMKEAGVSIIYWGGLHTEAGLIIRQAADQGLKATLVSG 247 G V + +FSA++ +K A ++++GG+ +AG ++RQ G+ A L+ G Sbjct: 194 GAAIVATQFTTDKATEFSAILTAVKSAAPDVVFYGGMDAQAGPLLRQMKQLGINAKLMGG 253 Query: 248 DGIVSNELASIAGDAVAGTLNTFGPDPTANPANKELVEKFKA-----AGFNPEAYTLYSY 302 DGI + L ++AGD +A ++ +E F+A G + Y Y Y Sbjct: 254 DGICTEGLVNLAGDGMADGQVICAEAGGVTGEEEKGMEAFRADFKKRTGGEVQLYAPYVY 313 Query: 303 AAMQTIAGAAKAAGSLDPEAVAKAMKEKGPFPTVLGDISFDEKGDPKIPGYIMYEWK 359 A+ +A + K AGS +P+ + K + V G ISFD KGD K +Y +K Sbjct: 314 DAVMVLADSIKKAGSAEPDRYLPYL-AKADYKGVTGRISFDSKGDIKNGSLTLYSYK 369 Lambda K H 0.314 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 380 Length adjustment: 30 Effective length of query: 351 Effective length of database: 350 Effective search space: 122850 Effective search space used: 122850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory