Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate WP_156924419.1 H566_RS0113170 crotonase/enoyl-CoA hydratase family protein
Query= BRENDA::O87873 (258 letters) >NCBI__GCF_000482785.1:WP_156924419.1 Length = 269 Score = 86.7 bits (213), Expect = 5e-22 Identities = 77/237 (32%), Positives = 116/237 (48%), Gaps = 23/237 (9%) Query: 12 LERDGSLLRLRLARP-KANIVDAAMIAAMRQA---LGEHLQAPALRAVLLDAEGPHFSFG 67 ++ G + +LRL RP K N ++ A+IA + L EH+ RAV+L EG HF G Sbjct: 20 IDAGGPVAQLRLRRPAKRNAINDALIAQIHTFFVNLPEHV-----RAVVLSGEGEHFCAG 74 Query: 68 ASVDEHMPDQCAQML----KSLHGLVREMLDSPVPILVALRGQCLGGGLEVAAAGNLLFA 123 + + D A ++ H + PVP++ L G +GGGLE+AAA ++ A Sbjct: 75 LDLGDLDGDAGAAAAIARSRAWHAAFDAIQYGPVPVIAVLHGAVIGGGLELAAACHVRVA 134 Query: 124 APDAKFGQPEIRLGVF-APAASCLLPPRVGQACAEDLLWSGRSIDGAEGHRIGLIDVLAE 182 A + PE + G+F S L +G A D++ +GR++D EG R+GL L Sbjct: 135 ETSAWYALPEGQRGIFVGGGGSVRLSRLIGIARMTDMMLTGRTLDAEEGARVGLSQYLV- 193 Query: 183 DPEAAALRWFDEHIARLSASS--LRFAVRAARCDSVPRIKQKLDTVEALYLEELMAS 237 P L AR++A++ FAV A +PRI + L L +E LM+S Sbjct: 194 -PAGEGLAEAGRIAARVAANAPMSNFAVLQA----LPRIAE-LPATGGLLMEALMSS 244 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 269 Length adjustment: 25 Effective length of query: 233 Effective length of database: 244 Effective search space: 56852 Effective search space used: 56852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory