Align BadK (characterized)
to candidate WP_028312589.1 H566_RS0118410 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_000482785.1:WP_028312589.1 Length = 264 Score = 276 bits (707), Expect = 2e-79 Identities = 138/247 (55%), Positives = 176/247 (71%) Query: 12 GRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIASMA 71 G V +I LNRP LNAL+ L LG AL +ADD IGA+V+ G+ +AFAAGADI +M Sbjct: 18 GGVAVIVLNRPKALNALSPDLTRELGAALDTLEADDTIGAVVVTGSAKAFAAGADIKAMK 77 Query: 72 AWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSAKFALP 131 WSY DVYG++FIT WE + RKP +AAVAG A GGGCELA+ CD ++A +A+F P Sbjct: 78 DWSYMDVYGADFITATWERLTTFRKPTIAAVAGYALGGGCELAMMCDFILAADTARFGQP 137 Query: 132 EIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRLRDETV 191 EI +G +PGAGGTQRL R IGK+KAM+M L+ R ++A EA+R GLVSR++ + L E + Sbjct: 138 EITIGTIPGAGGTQRLTRLIGKSKAMEMVLTGRMMDAAEAERAGLVSRILPAEELLPEAI 197 Query: 192 ALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQAFLEKR 251 A IA S P M KES+NRA+E+TLAEGI FERR H+ FA+ D +EG+ AF+EKR Sbjct: 198 KTAQKIAGMSRPIAMLAKESVNRAYETTLAEGIRFERRLFHSTFATEDQKEGMAAFVEKR 257 Query: 252 APCFSHR 258 AP F +R Sbjct: 258 APAFRNR 264 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 264 Length adjustment: 25 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory