Align cyclohexa-1,5-dienecarbonyl-CoA hydratase monomer (EC 4.2.1.100) (characterized)
to candidate WP_028312589.1 H566_RS0118410 enoyl-CoA hydratase
Query= metacyc::MONOMER-18320 (256 letters) >NCBI__GCF_000482785.1:WP_028312589.1 Length = 264 Score = 130 bits (326), Expect = 4e-35 Identities = 79/247 (31%), Positives = 127/247 (51%), Gaps = 6/247 (2%) Query: 14 VATITLNVPNS-NWLTIPMMKEINEALMDVKKDPTIQLLVFDHAGDKAFCDGVDVADHVP 72 VA I LN P + N L+ + +E+ AL ++ D TI +V + KAF G D+ Sbjct: 20 VAVIVLNRPKALNALSPDLTRELGAALDTLEADDTIGAVVVTGSA-KAFAAGADIKAMKD 78 Query: 73 EKVDEMI--DLFHGMFRNMAAMDVTSVCLVNGRSLGGGCELMAFCDIVIASEKAKIGQPE 130 ++ D + + ++ V G +LGGGCEL CD ++A++ A+ GQPE Sbjct: 79 WSYMDVYGADFITATWERLTTFRKPTIAAVAGYALGGGCELAMMCDFILAADTARFGQPE 138 Query: 131 INLAVFPPVAAAW-FPKIMGLKKAMELILTGKIISAKEAEAIGLVNVVLPVEGFREAAQK 189 I + P +++G KAME++LTG+++ A EAE GLV+ +LP E A K Sbjct: 139 ITIGTIPGAGGTQRLTRLIGKSKAMEMVLTGRMMDAAEAERAGLVSRILPAEELLPEAIK 198 Query: 190 FMADFTSKSRPVAMWARRAIMAGLNLDFLQALKASEIIYMQGCMATEDANEGLASFLEKR 249 SRP+AM A+ ++ + ++ ++ ATED EG+A+F+EKR Sbjct: 199 TAQKIAGMSRPIAMLAKESVNRAYETTLAEGIRFERRLF-HSTFATEDQKEGMAAFVEKR 257 Query: 250 KPVFKDK 256 P F+++ Sbjct: 258 APAFRNR 264 Lambda K H 0.322 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 264 Length adjustment: 24 Effective length of query: 232 Effective length of database: 240 Effective search space: 55680 Effective search space used: 55680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory