Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate WP_028312898.1 H566_RS0120480 acyl-CoA dehydrogenase family protein
Query= BRENDA::Q3JP94 (395 letters) >NCBI__GCF_000482785.1:WP_028312898.1 Length = 383 Score = 214 bits (546), Expect = 3e-60 Identities = 129/374 (34%), Positives = 198/374 (52%), Gaps = 2/374 (0%) Query: 15 DQQLADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGG 74 D +L D++RMVRD A +A+ ++APR R D MG +GLLG +PE +GG Sbjct: 3 DIELTDEQRMVRDMARDFARNEVAPRAEAWERDGWIDGNTVARMGGLGLLGMVVPEHWGG 62 Query: 75 PGLDYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWIG 134 G DYVSY L E+ D ++MS+ +S+ P+ G+D Q+ +LP+LA GE IG Sbjct: 63 AGTDYVSYALAVEEISAGDGALGALMSIHNSVGCGPLLAHGNDEQRRAWLPQLARGEAIG 122 Query: 135 CFGLTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLD-EDGRDEI 193 CF LTEP GS+ ++ TRA G + + G+K +++N+ A + +V+A D E G+ + Sbjct: 123 CFCLTEPQAGSEAHNLRTRAVLRNGDWVIDGAKQFVSNAKRAKLAIVFAVTDPELGKKGL 182 Query: 194 RGFILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENIL-PHVKGLRGPFTCLNS 252 F++ G + + K+G+RAS T + LD VP N+L +GL + L Sbjct: 183 SAFLVPTDTPGFAIQRVEHKMGIRASDTCAVALDGVRVPAANLLGERNRGLSIALSNLEG 242 Query: 253 ARYGIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLR 312 R GI ALG A + + A +Y +R QFGRP+ + I +KLADM+ +I VL Sbjct: 243 GRIGIGAQALGIARAAFEAALRYSRERVQFGRPIHEHAPIAEKLADMKVQINAARLLVLH 302 Query: 313 LGRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNT 372 R+K G + S K + A + A + GG G ++ V R+ + + Sbjct: 303 AARLKQAGLPCLSEASQAKLFASEMAERVCSAAVQIHGGYGYLADYAVERYYRDARITQI 362 Query: 373 YEGTHDIHALILGR 386 YEGT +I +++ R Sbjct: 363 YEGTSEIQRMLIAR 376 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 383 Length adjustment: 30 Effective length of query: 365 Effective length of database: 353 Effective search space: 128845 Effective search space used: 128845 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory