Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate WP_028310213.1 H566_RS0102680 branched-chain amino acid ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >NCBI__GCF_000482785.1:WP_028310213.1 Length = 309 Score = 449 bits (1154), Expect = e-131 Identities = 223/309 (72%), Positives = 271/309 (87%) Query: 1 MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQV 60 M+I +QQ+INGLVLGS+YALIALGYTMVYG+L LINFAHGD+LMVGA+ LS K +Q+ Sbjct: 1 MEILLQQLINGLVLGSVYALIALGYTMVYGILQLINFAHGDVLMVGALTALSTSKFLQEA 60 Query: 61 APGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAM 120 AP +PG + L+IA+ AI VC++V++ IER+AYRPLRNAPRLAPLITAIG+SI LQTLAM Sbjct: 61 APWMPGPLVLLIALAAAIVVCVLVNIGIERVAYRPLRNAPRLAPLITAIGMSITLQTLAM 120 Query: 121 MIWGRSPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRAT 180 +IW R+ + FP ++P+ P+ + GA I+P Q++++ L++ MVGLVL+V KTK+GRAMRAT Sbjct: 121 LIWSRNYMVFPALLPNAPMPLGGASITPVQVIIVLLSLALMVGLVLLVNKTKLGRAMRAT 180 Query: 181 AENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAV 240 AENPR+A LMGVD ++VIV+TFA+GA LAA+AGVM AANYS A F MGF+PGLKAF+AAV Sbjct: 181 AENPRVAALMGVDPDRVIVITFALGAALAAVAGVMIAANYSIAHFYMGFLPGLKAFTAAV 240 Query: 241 LGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGI 300 LGGIGN+YGAM+GG+LLGLIE+LGAGYIGDLTG LGSNYQDIFAFIVLIIVLTLRPSGI Sbjct: 241 LGGIGNLYGAMVGGLLLGLIEALGAGYIGDLTGGVLGSNYQDIFAFIVLIIVLTLRPSGI 300 Query: 301 MGERVADRA 309 MGERVADRA Sbjct: 301 MGERVADRA 309 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 309 Length adjustment: 27 Effective length of query: 282 Effective length of database: 282 Effective search space: 79524 Effective search space used: 79524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory