Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_034410867.1 H566_RS0104975 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000482785.1:WP_034410867.1 Length = 243 Score = 215 bits (548), Expect = 6e-61 Identities = 106/232 (45%), Positives = 153/232 (65%) Query: 10 LQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIEYL 69 L V GL AYG + V EV GE+ ++G+NGAGK+T ++AI G + + Sbjct: 12 LVVSGLTAAYGKADVLTDVSIEVEPGEITCILGANGAGKSTLIRAILSLTPPRAGKVSFG 71 Query: 70 GKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILADIEKMFTIF 129 G+ I G + + G+ +PEGR VF RMT+ ENL++GA+ D+A + ++++F IF Sbjct: 72 GRDITGLATHLVNRAGIACIPEGRKVFGRMTVLENLRIGAFGIADRAEVARRMDEVFAIF 131 Query: 130 PRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKIFEVVRDVY 189 PRL ER+ QL GTMSGGEQ ML++GR LM+ PK+LL+DEPS+GLSP+ V + F VV+ + Sbjct: 132 PRLAERRAQLGGTMSGGEQAMLSIGRGLMAAPKLLLIDEPSLGLSPLFVAETFAVVKRIN 191 Query: 190 ALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVRAAYLG 241 +G+T++LVEQN + LA+A RGYV+ G + G +L DP+V+AAY G Sbjct: 192 EMGITVLLVEQNVHQTLAVAHRGYVLAQGRVVARGSTAELKEDPEVKAAYFG 243 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 243 Length adjustment: 23 Effective length of query: 219 Effective length of database: 220 Effective search space: 48180 Effective search space used: 48180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory