Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_034410867.1 H566_RS0104975 ABC transporter ATP-binding protein
Query= TCDB::P21630 (233 letters) >NCBI__GCF_000482785.1:WP_034410867.1 Length = 243 Score = 217 bits (553), Expect = 1e-61 Identities = 108/223 (48%), Positives = 150/223 (67%), Gaps = 1/223 (0%) Query: 11 YGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPS 70 YGK L DVS+EV+ GEI ++GANGAGKSTL+ + +G + + G ++ GL + Sbjct: 21 YGKADVLTDVSIEVEPGEITCILGANGAGKSTLIRAILSLTPPRAGKVSFGGRDITGLAT 80 Query: 71 STIMRKSIAVVPEGRRVFSRLTVEENLAMGGF-FTDKDDYQVQMDKVLELFPRLKERYEQ 129 + R IA +PEGR+VF R+TV ENL +G F D+ + +MD+V +FPRL ER Q Sbjct: 81 HLVNRAGIACIPEGRKVFGRMTVLENLRIGAFGIADRAEVARRMDEVFAIFPRLAERRAQ 140 Query: 130 RAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLV 189 GTMSGGEQ ML+IGR LM+ PKLLL+DEPSLGL+P+ + + F +++++ G+TV LV Sbjct: 141 LGGTMSGGEQAMLSIGRGLMAAPKLLLIDEPSLGLSPLFVAETFAVVKRINEMGITVLLV 200 Query: 190 EQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLG 232 EQN +Q L +A R YVL GR+V + A L +P+V+ AY G Sbjct: 201 EQNVHQTLAVAHRGYVLAQGRVVARGSTAELKEDPEVKAAYFG 243 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 243 Length adjustment: 23 Effective length of query: 210 Effective length of database: 220 Effective search space: 46200 Effective search space used: 46200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory