Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_084545003.1 H566_RS0111180 enoyl-CoA hydratase-related protein
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000482785.1:WP_084545003.1 Length = 298 Score = 141 bits (355), Expect = 2e-38 Identities = 88/260 (33%), Positives = 140/260 (53%), Gaps = 8/260 (3%) Query: 6 IETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKG-KAFCAG 64 + ++G++ +T++RPD LNA+++ L RA+ E+DP+ ++++TG G +AF AG Sbjct: 39 VRLDRDGHVARLTIDRPDALNAMDSHAHLALSRALDAIEADPDCWIVVLTGAGERAFSAG 98 Query: 65 ADITQFNQ---LTPAEAWKFSKKG---REIMDKIEALSKPTIAMINGYALGGGLELALAC 118 D+ + + + AE + + R + D+ + +P IA +NG ALGGG ELALAC Sbjct: 99 RDLKEVAREPLMDEAERAALAARWAGLRRLTDRHDFF-RPVIARVNGMALGGGFELALAC 157 Query: 119 DIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLV 178 D+ +AAE A LPE G+ GG RL R + A+ M++TG + ++A +GLV Sbjct: 158 DVIVAAEHASFALPEPRRGLVAMAGGMHRLPRQLPLKLAMGMLLTGRPLAAREALAHGLV 217 Query: 179 NRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFST 238 N VVP A+L+ + + +P+SL K+ GL PL +A + Sbjct: 218 NEVVPAADLDVAVGRWVADMLACAPLSLQATKQCAMAGLGRPLAEAMAASYPLEARRKRS 277 Query: 239 EDKKEGVSAFLEKREPTFKG 258 D EG AF E+R P + G Sbjct: 278 ADSIEGPRAFAERRSPRWTG 297 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 298 Length adjustment: 25 Effective length of query: 234 Effective length of database: 273 Effective search space: 63882 Effective search space used: 63882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory