Align BadH (characterized)
to candidate WP_027458474.1 K420_RS0113145 3-oxoacyl-ACP reductase FabG
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_000519045.1:WP_027458474.1 Length = 246 Score = 150 bits (379), Expect = 2e-41 Identities = 87/251 (34%), Positives = 130/251 (51%), Gaps = 6/251 (2%) Query: 4 LQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRCD 63 L +K A++TG GIG A ++GA + + D A K++ + ++G + + Sbjct: 2 LNDKIALVTGATRGIGRAIALELGRQGATVIGTATSEDGAGKISAYLTESGVKGRGIVLN 61 Query: 64 IADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHH 123 + D DA +A LG + ILVNNAG + EW+ +I NL + Sbjct: 62 VTDAAQTDAVLADIAKELGAITILVNNAGITRDNLAMRMGDDEWDAVIDTNLKAVFRLSR 121 Query: 124 AVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNVV 183 V+ GM++ R GRIVNI+S G+ G+A Y A K G+ S++LARE ITVN V Sbjct: 122 GVMRGMMKARFGRIVNISSVVGYSGNPGQANYCAAKAGVAGLSRSLARELGSRNITVNCV 181 Query: 184 CPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITGQ 243 PG + D+T +K A +IPLGR G P+D+AGA+ F S A ++TG Sbjct: 182 APG----FIATDMTHALTEEQK--AAMLASIPLGRAGTPEDVAGAVGFLVSPAASYVTGT 235 Query: 244 VLSVSGGLTMN 254 + V+GG+ M+ Sbjct: 236 TVHVNGGMFMD 246 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 246 Length adjustment: 24 Effective length of query: 231 Effective length of database: 222 Effective search space: 51282 Effective search space used: 51282 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory