Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_027456480.1 K420_RS0101415 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_000519045.1:WP_027456480.1 Length = 253 Score = 172 bits (436), Expect = 6e-48 Identities = 92/254 (36%), Positives = 153/254 (60%), Gaps = 4/254 (1%) Query: 1 MGILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSV 60 M +LEVK++ FGG++A+ +V+ ++ V+++IGPNGAGK+TL N + G P TG + Sbjct: 1 MSLLEVKDLSIHFGGVKAVQNVSFNIDSGIVYSVIGPNGAGKTTLFNLITGVYKPTTGEI 60 Query: 61 MFDGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAI---S 117 DG+++ G++P E+ + G++R FQ +I ++S +EN+M+ + D A+ S Sbjct: 61 RLDGEAIHGKSPNELARRGVARTFQNLQICMNMSAIENVMVGAHLRLDRNLVKAALRFPS 120 Query: 118 AVSGQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTA 177 R + ++A +++ + +A A +MS G +RLEI L+ +PRL+ LDEP A Sbjct: 121 LKQRDRTLRDEAAQLMDFVGLAQYVETRADAMSYGALKRLEIARALAMKPRLIFLDEPAA 180 Query: 178 GMARADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIK 237 G+ +T L+++I ++ IT+ ++EHDM +V +L+DRI VL G L E + I+ Sbjct: 181 GLNPKETIEVDHLVRKI-ADSGITVVLVEHDMKMVMNLSDRILVLDYGKKLAEGSGEEIR 239 Query: 238 GNPKVREAYLGESA 251 NP V AYLG A Sbjct: 240 KNPDVIAAYLGAHA 253 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 253 Length adjustment: 24 Effective length of query: 227 Effective length of database: 229 Effective search space: 51983 Effective search space used: 51983 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory