Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_027456718.1 K420_RS0102830 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_000519045.1:WP_027456718.1 Length = 257 Score = 185 bits (469), Expect = 9e-52 Identities = 98/249 (39%), Positives = 155/249 (62%), Gaps = 4/249 (1%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 +LE K V K FGG++AL DV+L++R ++ +IGPNGAGK+T NC+ G +PD G +F Sbjct: 9 LLEAKAVAKHFGGVKALRDVSLTIRRGEIYGLIGPNGAGKTTFFNCMTGLYVPDGGGFVF 68 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAK-RDGAF--EMNAISAV 119 DG ++ AP++ + GI+R FQ +FG+++ LEN+M+ + R G +N + Sbjct: 69 DGVPLVADAPHQAAERGIARTFQNIRLFGNMTALENVMVGRHVRTRAGVLGAMLNNAATR 128 Query: 120 SGQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGM 179 + + I ++A +L + + D+ A ++S GD+RRLEI L+ EP+LL LDEP AGM Sbjct: 129 AEEAAIRQRAMDLLHYVRIEDRADDLAKNLSYGDQRRLEIARALASEPKLLCLDEPAAGM 188 Query: 180 ARADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGN 239 +T +L++ I+ + TI +IEHD+ +V L DR+ VL G ++ED P ++ + Sbjct: 189 NATETAELRELIEGIRRD-GTTILLIEHDVKLVMGLCDRVAVLDYGALVIEDVPAVVQKD 247 Query: 240 PKVREAYLG 248 +V EAYLG Sbjct: 248 QRVIEAYLG 256 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 257 Length adjustment: 24 Effective length of query: 227 Effective length of database: 233 Effective search space: 52891 Effective search space used: 52891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory